Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRL8A4, Rat (HEK293, His)

The PRL8A4 protein is involved in regulating cells in the basal zone of the placenta, suggesting a potential impact on placental development. Although important, the specific functions and molecular mechanisms of PRL8A4 in these cells require further exploration. PRL8A4 Protein, Rat (HEK293, His) is the recombinant rat-derived PRL8A4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

PRL8A4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prl8a4-protein-rat-hek293-his.html

Purity

96.0

Smiles

IPACMVEEGDCWDPLQETFNSAIQRAETLCNLADQLYVEFYQNQFSSRQFADLNSKLIKRDETVLKAGIYCHSTLAKPQTRGGNFEIEEHLKMLINFVGSWISPLFHLVIELSAMEGVPETILCKVKDLEENNRQLLDDLRWILTKVSPTAEIREEFPSWEHLSFLKSSNKNNKFLAMFNLSNCLDNDTKFTLHHLRIFKCLITGKDC

Molecular Formula

59088 (Gene_ID) P33580 (I32-C239) (Accession)

Molecular Weight

Approximately 24 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS24 Recombinant Protein Antigen
NBP2-68954PEP 100 µL

VPS24 Recombinant Protein Antigen

Sign In for Pricing
View Details
GABA A Receptor alpha 6 (GABRA6) Rabbit Polyclonal Antibody
TA355723 100 µL

GABA A Receptor alpha 6 (GABRA6) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LTA protein, Human, Recombinant (His)
E51P90004 20 µg

LTA protein, Human, Recombinant (His)

Sign In for Pricing
View Details
OPN Antibody Pair Set
MBS2577761-01 1 Pair

OPN Antibody Pair Set

Sign In for Pricing
View Details
OPN Antibody Pair Set
MBS2577761-02 5x 1 Pair

OPN Antibody Pair Set

Sign In for Pricing
View Details
TARS (Threonyl tRNA Synthetase, Cytoplasmic) BioAssayTM ELISA Kit (Mouse) discontinued
384549 96 Tests

TARS (Threonyl tRNA Synthetase, Cytoplasmic) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details