Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRL8A4, Rat (HEK293, His)

The PRL8A4 protein is involved in regulating cells in the basal zone of the placenta, suggesting a potential impact on placental development. Although important, the specific functions and molecular mechanisms of PRL8A4 in these cells require further exploration. PRL8A4 Protein, Rat (HEK293, His) is the recombinant rat-derived PRL8A4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

PRL8A4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prl8a4-protein-rat-hek293-his.html

Purity

96.0

Smiles

IPACMVEEGDCWDPLQETFNSAIQRAETLCNLADQLYVEFYQNQFSSRQFADLNSKLIKRDETVLKAGIYCHSTLAKPQTRGGNFEIEEHLKMLINFVGSWISPLFHLVIELSAMEGVPETILCKVKDLEENNRQLLDDLRWILTKVSPTAEIREEFPSWEHLSFLKSSNKNNKFLAMFNLSNCLDNDTKFTLHHLRIFKCLITGKDC

Molecular Formula

59088 (Gene_ID) P33580 (I32-C239) (Accession)

Molecular Weight

Approximately 24 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRAT Protein Vector (Rat) (pPB-C-His)
PV279822 500 ng

LRAT Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
SAPAP1 (E817) polyclonal antibody
BS1864-01 50 µL

SAPAP1 (E817) polyclonal antibody

Sign In for Pricing
View Details
SAPAP1 (E817) polyclonal antibody
BS1864-02 100 µL

SAPAP1 (E817) polyclonal antibody

Sign In for Pricing
View Details
Hsa-miR-3605-5p miRNA Mimic
CMH1091-01 5 nmol

Hsa-miR-3605-5p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-3605-5p miRNA Mimic
CMH1091-02 10 nmol

Hsa-miR-3605-5p miRNA Mimic

Sign In for Pricing
View Details
Mouse Heparanase1 (HPA1) ELISA Kit
QY-E20734 96 Tests

Mouse Heparanase1 (HPA1) ELISA Kit

Sign In for Pricing
View Details