Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRL8A4, Rat (HEK293, His)

The PRL8A4 protein is involved in regulating cells in the basal zone of the placenta, suggesting a potential impact on placental development. Although important, the specific functions and molecular mechanisms of PRL8A4 in these cells require further exploration. PRL8A4 Protein, Rat (HEK293, His) is the recombinant rat-derived PRL8A4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

PRL8A4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prl8a4-protein-rat-hek293-his.html

Purity

96.0

Smiles

IPACMVEEGDCWDPLQETFNSAIQRAETLCNLADQLYVEFYQNQFSSRQFADLNSKLIKRDETVLKAGIYCHSTLAKPQTRGGNFEIEEHLKMLINFVGSWISPLFHLVIELSAMEGVPETILCKVKDLEENNRQLLDDLRWILTKVSPTAEIREEFPSWEHLSFLKSSNKNNKFLAMFNLSNCLDNDTKFTLHHLRIFKCLITGKDC

Molecular Formula

59088 (Gene_ID) P33580 (I32-C239) (Accession)

Molecular Weight

Approximately 24 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Tachykinin Receptor 3 ELISA Kit
MBS008417-01 48 Well

Porcine Tachykinin Receptor 3 ELISA Kit

Sign In for Pricing
View Details
Porcine Tachykinin Receptor 3 ELISA Kit
MBS008417-02 96 Well

Porcine Tachykinin Receptor 3 ELISA Kit

Sign In for Pricing
View Details
Porcine Tachykinin Receptor 3 ELISA Kit
MBS008417-03 5x 96 Well

Porcine Tachykinin Receptor 3 ELISA Kit

Sign In for Pricing
View Details
Porcine Tachykinin Receptor 3 ELISA Kit
MBS008417-04 10x 96 Well

Porcine Tachykinin Receptor 3 ELISA Kit

Sign In for Pricing
View Details
GM-CSF R alpha, His, Cynomolgus
Z04804-500 500 µg

GM-CSF R alpha, His, Cynomolgus

Sign In for Pricing
View Details
Rabbit Polyclonal N-Acetylglucosaminyltransferase III/MGAT3 Antibody
NBP1-81810 0.1 mL

Rabbit Polyclonal N-Acetylglucosaminyltransferase III/MGAT3 Antibody

Sign In for Pricing
View Details