Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRL8A4, Rat (HEK293, His)

The PRL8A4 protein is involved in regulating cells in the basal zone of the placenta, suggesting a potential impact on placental development. Although important, the specific functions and molecular mechanisms of PRL8A4 in these cells require further exploration. PRL8A4 Protein, Rat (HEK293, His) is the recombinant rat-derived PRL8A4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

PRL8A4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prl8a4-protein-rat-hek293-his.html

Purity

96.0

Smiles

IPACMVEEGDCWDPLQETFNSAIQRAETLCNLADQLYVEFYQNQFSSRQFADLNSKLIKRDETVLKAGIYCHSTLAKPQTRGGNFEIEEHLKMLINFVGSWISPLFHLVIELSAMEGVPETILCKVKDLEENNRQLLDDLRWILTKVSPTAEIREEFPSWEHLSFLKSSNKNNKFLAMFNLSNCLDNDTKFTLHHLRIFKCLITGKDC

Molecular Formula

59088 (Gene_ID) P33580 (I32-C239) (Accession)

Molecular Weight

Approximately 24 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Florfenicol ELISA Kit
DEIA039 96T

Florfenicol ELISA Kit

Sign In for Pricing
View Details
hsa-miR-8056 miRNA Antagomir
MNH03855 2x 5.0 nmol

hsa-miR-8056 miRNA Antagomir

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At2g44630 Polyclonal Antibody
MBS7183304 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At2g44630 Polyclonal Antibody

Sign In for Pricing
View Details
IMP3 Recombinant Antibody, Cy5.5 Conjugated
bsm-61766R-Cy5.5 100 µL

IMP3 Recombinant Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Ick sgRNA CRISPR Lentivector (Rat) (Target 2)
K7080403 1.0 µg DNA

Ick sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
MAPRE1, NT (MAPRE1, Microtubule-associated protein RP/EB family member 1, APC-binding protein EB1, End-binding protein 1) (Azide free) (HRP)
MBS6318906-01 0.2 mL

MAPRE1, NT (MAPRE1, Microtubule-associated protein RP/EB family member 1, APC-binding protein EB1, End-binding protein 1) (Azide free) (HRP)

Sign In for Pricing
View Details