Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRL8A4, Rat (HEK293, His)

The PRL8A4 protein is involved in regulating cells in the basal zone of the placenta, suggesting a potential impact on placental development. Although important, the specific functions and molecular mechanisms of PRL8A4 in these cells require further exploration. PRL8A4 Protein, Rat (HEK293, His) is the recombinant rat-derived PRL8A4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

PRL8A4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prl8a4-protein-rat-hek293-his.html

Purity

96.0

Smiles

IPACMVEEGDCWDPLQETFNSAIQRAETLCNLADQLYVEFYQNQFSSRQFADLNSKLIKRDETVLKAGIYCHSTLAKPQTRGGNFEIEEHLKMLINFVGSWISPLFHLVIELSAMEGVPETILCKVKDLEENNRQLLDDLRWILTKVSPTAEIREEFPSWEHLSFLKSSNKNNKFLAMFNLSNCLDNDTKFTLHHLRIFKCLITGKDC

Molecular Formula

59088 (Gene_ID) P33580 (I32-C239) (Accession)

Molecular Weight

Approximately 24 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Desmin (DES) Rabbit Polyclonal Antibody
AP06608PU-N 100 µg

Desmin (DES) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ints12 Mouse shRNA Lentiviral Particle (Locus ID 71793)
TL504619V 500 µL Each

Ints12 Mouse shRNA Lentiviral Particle (Locus ID 71793)

Sign In for Pricing
View Details
Fluor700-conjugated Polyclonal Rabbit Anti-Human IgG (H+L) Secondary Antibody
APS0685-01 200 µL

Fluor700-conjugated Polyclonal Rabbit Anti-Human IgG (H+L) Secondary Antibody

Sign In for Pricing
View Details
Fluor700-conjugated Polyclonal Rabbit Anti-Human IgG (H+L) Secondary Antibody
APS0685-02 500 µL

Fluor700-conjugated Polyclonal Rabbit Anti-Human IgG (H+L) Secondary Antibody

Sign In for Pricing
View Details
DTD1 (NM_080820) Human Over-expression Lysate
LS092675-100ug 100 µg

DTD1 (NM_080820) Human Over-expression Lysate

Sign In for Pricing
View Details
Cadherin-13, NT (Cadherin, H, Truncated Cadherin, T-cadherin, T-cad, Heart Cadherin, H-cadherin, P105, CDH13, CDHH) (APC) discontinued
C0108-50G-APC 200 µL

Cadherin-13, NT (Cadherin, H, Truncated Cadherin, T-cadherin, T-cad, Heart Cadherin, H-cadherin, P105, CDH13, CDHH) (APC) discontinued

Sign In for Pricing
View Details