Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRL8A4, Rat (HEK293, His)

The PRL8A4 protein is involved in regulating cells in the basal zone of the placenta, suggesting a potential impact on placental development. Although important, the specific functions and molecular mechanisms of PRL8A4 in these cells require further exploration. PRL8A4 Protein, Rat (HEK293, His) is the recombinant rat-derived PRL8A4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

PRL8A4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prl8a4-protein-rat-hek293-his.html

Purity

96.0

Smiles

IPACMVEEGDCWDPLQETFNSAIQRAETLCNLADQLYVEFYQNQFSSRQFADLNSKLIKRDETVLKAGIYCHSTLAKPQTRGGNFEIEEHLKMLINFVGSWISPLFHLVIELSAMEGVPETILCKVKDLEENNRQLLDDLRWILTKVSPTAEIREEFPSWEHLSFLKSSNKNNKFLAMFNLSNCLDNDTKFTLHHLRIFKCLITGKDC

Molecular Formula

59088 (Gene_ID) P33580 (I32-C239) (Accession)

Molecular Weight

Approximately 24 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL15P13 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV776812 1.0 µg DNA

RPL15P13 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
OR52P1P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1569707 1.0 µg DNA

OR52P1P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Nibrin (Nijmegen Breakage Syndrome, NBS1) (APC)
MBS6242384-01 0.1 mL

Nibrin (Nijmegen Breakage Syndrome, NBS1) (APC)

Sign In for Pricing
View Details
Nibrin (Nijmegen Breakage Syndrome, NBS1) (APC)
MBS6242384-02 5x 0.1 mL

Nibrin (Nijmegen Breakage Syndrome, NBS1) (APC)

Sign In for Pricing
View Details
TMBIM1 polyclonal antibody
BS72385-01 50 µL

TMBIM1 polyclonal antibody

Sign In for Pricing
View Details
TMBIM1 polyclonal antibody
BS72385-02 100 µL

TMBIM1 polyclonal antibody

Sign In for Pricing
View Details