Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRL8A4, Rat (HEK293, His)

The PRL8A4 protein is involved in regulating cells in the basal zone of the placenta, suggesting a potential impact on placental development. Although important, the specific functions and molecular mechanisms of PRL8A4 in these cells require further exploration. PRL8A4 Protein, Rat (HEK293, His) is the recombinant rat-derived PRL8A4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

PRL8A4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prl8a4-protein-rat-hek293-his.html

Purity

96.0

Smiles

IPACMVEEGDCWDPLQETFNSAIQRAETLCNLADQLYVEFYQNQFSSRQFADLNSKLIKRDETVLKAGIYCHSTLAKPQTRGGNFEIEEHLKMLINFVGSWISPLFHLVIELSAMEGVPETILCKVKDLEENNRQLLDDLRWILTKVSPTAEIREEFPSWEHLSFLKSSNKNNKFLAMFNLSNCLDNDTKFTLHHLRIFKCLITGKDC

Molecular Formula

59088 (Gene_ID) P33580 (I32-C239) (Accession)

Molecular Weight

Approximately 24 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BIO5192 hydrate
MF-0139732-01 100 mg

BIO5192 hydrate

Sign In for Pricing
View Details
BIO5192 hydrate
MF-0139732-02 50 mg

BIO5192 hydrate

Sign In for Pricing
View Details
Lentiviral human CDK9 shRNA (UAS) - Lentiviral human CDK9 shRNA (UAS, iRFP) (100)
GTR15311454 1 Vial

Lentiviral human CDK9 shRNA (UAS) - Lentiviral human CDK9 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
APOE Knockout Cell Lysate
ABC-KC0099 100 µg

APOE Knockout Cell Lysate

Sign In for Pricing
View Details
NPFF2 (Neuropeptide FF2, NPFF-2, NPFF 2) (MaxLight 750) discontinued
301430-ML750 100 µL

NPFF2 (Neuropeptide FF2, NPFF-2, NPFF 2) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Monoclonal PAX5 Antibody (clone 1H9), Clone: 1H9
APR12733G 0.05mg

Monoclonal PAX5 Antibody (clone 1H9), Clone: 1H9

Sign In for Pricing
View Details