Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRL8A4, Rat (HEK293, His)

The PRL8A4 protein is involved in regulating cells in the basal zone of the placenta, suggesting a potential impact on placental development. Although important, the specific functions and molecular mechanisms of PRL8A4 in these cells require further exploration. PRL8A4 Protein, Rat (HEK293, His) is the recombinant rat-derived PRL8A4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

PRL8A4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prl8a4-protein-rat-hek293-his.html

Purity

96.0

Smiles

IPACMVEEGDCWDPLQETFNSAIQRAETLCNLADQLYVEFYQNQFSSRQFADLNSKLIKRDETVLKAGIYCHSTLAKPQTRGGNFEIEEHLKMLINFVGSWISPLFHLVIELSAMEGVPETILCKVKDLEENNRQLLDDLRWILTKVSPTAEIREEFPSWEHLSFLKSSNKNNKFLAMFNLSNCLDNDTKFTLHHLRIFKCLITGKDC

Molecular Formula

59088 (Gene_ID) P33580 (I32-C239) (Accession)

Molecular Weight

Approximately 24 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Cpsf4 shRNA (UAS) - Lentiviral mouse Cpsf4 shRNA (UAS, GFP) plasmid
GTR15297253 1 Vial

Lentiviral mouse Cpsf4 shRNA (UAS) - Lentiviral mouse Cpsf4 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
FHOD1 (NM_013241) Human Over-expression Lysate
LH08854V 100 µg

FHOD1 (NM_013241) Human Over-expression Lysate

Sign In for Pricing
View Details
Camel Intercellular Adhesion Molecule 2 ELISA Kit
MBS076319-01 48 Well

Camel Intercellular Adhesion Molecule 2 ELISA Kit

Sign In for Pricing
View Details
Camel Intercellular Adhesion Molecule 2 ELISA Kit
MBS076319-02 96 Well

Camel Intercellular Adhesion Molecule 2 ELISA Kit

Sign In for Pricing
View Details
Camel Intercellular Adhesion Molecule 2 ELISA Kit
MBS076319-03 5x 96 Well

Camel Intercellular Adhesion Molecule 2 ELISA Kit

Sign In for Pricing
View Details
Camel Intercellular Adhesion Molecule 2 ELISA Kit
MBS076319-04 10x 96 Well

Camel Intercellular Adhesion Molecule 2 ELISA Kit

Sign In for Pricing
View Details