Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRL8A4, Rat (HEK293, His)

The PRL8A4 protein is involved in regulating cells in the basal zone of the placenta, suggesting a potential impact on placental development. Although important, the specific functions and molecular mechanisms of PRL8A4 in these cells require further exploration. PRL8A4 Protein, Rat (HEK293, His) is the recombinant rat-derived PRL8A4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

PRL8A4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prl8a4-protein-rat-hek293-his.html

Purity

96.0

Smiles

IPACMVEEGDCWDPLQETFNSAIQRAETLCNLADQLYVEFYQNQFSSRQFADLNSKLIKRDETVLKAGIYCHSTLAKPQTRGGNFEIEEHLKMLINFVGSWISPLFHLVIELSAMEGVPETILCKVKDLEENNRQLLDDLRWILTKVSPTAEIREEFPSWEHLSFLKSSNKNNKFLAMFNLSNCLDNDTKFTLHHLRIFKCLITGKDC

Molecular Formula

59088 (Gene_ID) P33580 (I32-C239) (Accession)

Molecular Weight

Approximately 24 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHST5, CT (CHST5, Carbohydrate sulfotransferase 5, Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 4-alpha, Intestinal N-acetylglucosamine-6-O-sulfotransferase, N-acetylglucosamine 6-O-sulfotransferase 3) (APC) discontinued
033885-APC 200 µL

CHST5, CT (CHST5, Carbohydrate sulfotransferase 5, Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 4-alpha, Intestinal N-acetylglucosamine-6-O-sulfotransferase, N-acetylglucosamine 6-O-sulfotransferase 3) (APC) discontinued

Sign In for Pricing
View Details
Human PYDC2 qPCR Primer Pair
QH65569S 200 Tests

Human PYDC2 qPCR Primer Pair

Sign In for Pricing
View Details
OCEL1 Polyclonal Antibody, APC-Cy7 Conjugated
bs-9368R-APC-Cy7 100 µL

OCEL1 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
TRIML1 Antibody
A62071-100UG 100 µg

TRIML1 Antibody

Sign In for Pricing
View Details
Indole-3-acetyl glutamate-d4
HY-W588263S1 1 Each

Indole-3-acetyl glutamate-d4

Sign In for Pricing
View Details
Elsiglutide
HY-P3498-01 1 mg

Elsiglutide

Sign In for Pricing
View Details