Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRL8A4, Rat (HEK293, His)

The PRL8A4 protein is involved in regulating cells in the basal zone of the placenta, suggesting a potential impact on placental development. Although important, the specific functions and molecular mechanisms of PRL8A4 in these cells require further exploration. PRL8A4 Protein, Rat (HEK293, His) is the recombinant rat-derived PRL8A4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

PRL8A4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prl8a4-protein-rat-hek293-his.html

Purity

96.0

Smiles

IPACMVEEGDCWDPLQETFNSAIQRAETLCNLADQLYVEFYQNQFSSRQFADLNSKLIKRDETVLKAGIYCHSTLAKPQTRGGNFEIEEHLKMLINFVGSWISPLFHLVIELSAMEGVPETILCKVKDLEENNRQLLDDLRWILTKVSPTAEIREEFPSWEHLSFLKSSNKNNKFLAMFNLSNCLDNDTKFTLHHLRIFKCLITGKDC

Molecular Formula

59088 (Gene_ID) P33580 (I32-C239) (Accession)

Molecular Weight

Approximately 24 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PNKD Antibody
MBS9400850-01 0.1 mL

PNKD Antibody

Sign In for Pricing
View Details
PNKD Antibody
MBS9400850-02 5x 0.1 mL

PNKD Antibody

Sign In for Pricing
View Details
GDPD5 Polyclonal Antibody, HRP Conjugated
bs-9207R-HRP 100 µL

GDPD5 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Zeb1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
50811116 3x 1.0 µg

Zeb1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
D-dimer Antigen >90%
ND-R0693 1 Each

D-dimer Antigen >90%

Sign In for Pricing
View Details
Mouse Exosome component 10, EXOSC10 ELISA Kit
MBS9325751-01 48 Well

Mouse Exosome component 10, EXOSC10 ELISA Kit

Sign In for Pricing
View Details