Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRL8A4, Rat (HEK293, His)

The PRL8A4 protein is involved in regulating cells in the basal zone of the placenta, suggesting a potential impact on placental development. Although important, the specific functions and molecular mechanisms of PRL8A4 in these cells require further exploration. PRL8A4 Protein, Rat (HEK293, His) is the recombinant rat-derived PRL8A4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

PRL8A4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prl8a4-protein-rat-hek293-his.html

Purity

96.0

Smiles

IPACMVEEGDCWDPLQETFNSAIQRAETLCNLADQLYVEFYQNQFSSRQFADLNSKLIKRDETVLKAGIYCHSTLAKPQTRGGNFEIEEHLKMLINFVGSWISPLFHLVIELSAMEGVPETILCKVKDLEENNRQLLDDLRWILTKVSPTAEIREEFPSWEHLSFLKSSNKNNKFLAMFNLSNCLDNDTKFTLHHLRIFKCLITGKDC

Molecular Formula

59088 (Gene_ID) P33580 (I32-C239) (Accession)

Molecular Weight

Approximately 24 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

WBSCR23 Human shRNA Plasmid Kit (Locus ID 80112)
TR318725 1 Kit

WBSCR23 Human shRNA Plasmid Kit (Locus ID 80112)

Sign In for Pricing
View Details
RGD621098 Protein Vector (Rat) (pPM-C-His)
PV301197 500 ng

RGD621098 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
ASPHD2 Protein Vector (Human) (pPM-N-D-C-His)
PV324445 500 ng

ASPHD2 Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing
View Details
WWC3 AAV siRNA Pooled Vector
50484161 1.0 µg

WWC3 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Human SLC35F4 Pre-designed siRNA Set A
SI015072A 1 Each

Human SLC35F4 Pre-designed siRNA Set A

Sign In for Pricing
View Details
WT1 (Wilm's Tumor 1, GUD, AWT1, WAGR, WT33, NPHS4, WIT-2, EWS-WT1) (MaxLight 490)
MBS6443519-01 0.1 mL

WT1 (Wilm's Tumor 1, GUD, AWT1, WAGR, WT33, NPHS4, WIT-2, EWS-WT1) (MaxLight 490)

Sign In for Pricing
View Details