Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRL8A4, Rat (HEK293, His)

The PRL8A4 protein is involved in regulating cells in the basal zone of the placenta, suggesting a potential impact on placental development. Although important, the specific functions and molecular mechanisms of PRL8A4 in these cells require further exploration. PRL8A4 Protein, Rat (HEK293, His) is the recombinant rat-derived PRL8A4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

PRL8A4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prl8a4-protein-rat-hek293-his.html

Purity

96.0

Smiles

IPACMVEEGDCWDPLQETFNSAIQRAETLCNLADQLYVEFYQNQFSSRQFADLNSKLIKRDETVLKAGIYCHSTLAKPQTRGGNFEIEEHLKMLINFVGSWISPLFHLVIELSAMEGVPETILCKVKDLEENNRQLLDDLRWILTKVSPTAEIREEFPSWEHLSFLKSSNKNNKFLAMFNLSNCLDNDTKFTLHHLRIFKCLITGKDC

Molecular Formula

59088 (Gene_ID) P33580 (I32-C239) (Accession)

Molecular Weight

Approximately 24 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal mGluR6 Antibody [mFluor Violet 450 SE]
NB300-189MFV450 0.1 mL

Rabbit Polyclonal mGluR6 Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Balance 220g(0.001g) Internal Calibration - EACH
BAL1380 1 Each

Balance 220g(0.001g) Internal Calibration - EACH

Sign In for Pricing
View Details
LOC100365761 3'UTR GFP Stable Cell Line
TU259623 1.0 mL

LOC100365761 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Lectin Galactoside Binding (Soluble 3 Binding Protein (GAL3BP) Human ELISA Kit
E6160 96 Tests

Lectin Galactoside Binding (Soluble 3 Binding Protein (GAL3BP) Human ELISA Kit

Sign In for Pricing
View Details
CES2, ID (CES2, ICE, Cocaine esterase, Carboxylesterase 2, Methylumbelliferyl-acetate deacetylase 2) (Biotin) discontinued
033793-Biotin 200 µL

CES2, ID (CES2, ICE, Cocaine esterase, Carboxylesterase 2, Methylumbelliferyl-acetate deacetylase 2) (Biotin) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Selenbp1 shRNA (UAS) - Lentiviral mouse Selenbp1 shRNA (UAS, RFP) (25)
GTR15171467 1 Vial

Lentiviral mouse Selenbp1 shRNA (UAS) - Lentiviral mouse Selenbp1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details