Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRL8A4, Rat (HEK293, His)

The PRL8A4 protein is involved in regulating cells in the basal zone of the placenta, suggesting a potential impact on placental development. Although important, the specific functions and molecular mechanisms of PRL8A4 in these cells require further exploration. PRL8A4 Protein, Rat (HEK293, His) is the recombinant rat-derived PRL8A4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

PRL8A4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prl8a4-protein-rat-hek293-his.html

Purity

96.0

Smiles

IPACMVEEGDCWDPLQETFNSAIQRAETLCNLADQLYVEFYQNQFSSRQFADLNSKLIKRDETVLKAGIYCHSTLAKPQTRGGNFEIEEHLKMLINFVGSWISPLFHLVIELSAMEGVPETILCKVKDLEENNRQLLDDLRWILTKVSPTAEIREEFPSWEHLSFLKSSNKNNKFLAMFNLSNCLDNDTKFTLHHLRIFKCLITGKDC

Molecular Formula

59088 (Gene_ID) P33580 (I32-C239) (Accession)

Molecular Weight

Approximately 24 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC42EP4 (Cdc42 Effector Protein 4, Binder of Rho GTPases 4, BORG4, CEP4)
MBS6003018-01 0.05 mg

CDC42EP4 (Cdc42 Effector Protein 4, Binder of Rho GTPases 4, BORG4, CEP4)

Sign In for Pricing
View Details
CDC42EP4 (Cdc42 Effector Protein 4, Binder of Rho GTPases 4, BORG4, CEP4)
MBS6003018-02 5x 0.05 mg

CDC42EP4 (Cdc42 Effector Protein 4, Binder of Rho GTPases 4, BORG4, CEP4)

Sign In for Pricing
View Details
Recombinant Methanococcus maripaludis Tetrahydromethanopterin S-methyltransferase subunit D (mtrD), partial
MBS7089474 Inquire

Recombinant Methanococcus maripaludis Tetrahydromethanopterin S-methyltransferase subunit D (mtrD), partial

Sign In for Pricing
View Details
ERBB3 Protein (N-GST, Human)
P524413 100 µg

ERBB3 Protein (N-GST, Human)

Sign In for Pricing
View Details
ZFP64 (NM_199427) Human Over-expression Lysate
LC404559 20 µg

ZFP64 (NM_199427) Human Over-expression Lysate

Sign In for Pricing
View Details
Influenza A Virus H3N2 Kiev 301/94 like /Johannesburg 33/94
7-07939 10 µg

Influenza A Virus H3N2 Kiev 301/94 like /Johannesburg 33/94

Sign In for Pricing
View Details