Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRL8A4, Rat (HEK293, His)

The PRL8A4 protein is involved in regulating cells in the basal zone of the placenta, suggesting a potential impact on placental development. Although important, the specific functions and molecular mechanisms of PRL8A4 in these cells require further exploration. PRL8A4 Protein, Rat (HEK293, His) is the recombinant rat-derived PRL8A4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

PRL8A4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prl8a4-protein-rat-hek293-his.html

Purity

96.0

Smiles

IPACMVEEGDCWDPLQETFNSAIQRAETLCNLADQLYVEFYQNQFSSRQFADLNSKLIKRDETVLKAGIYCHSTLAKPQTRGGNFEIEEHLKMLINFVGSWISPLFHLVIELSAMEGVPETILCKVKDLEENNRQLLDDLRWILTKVSPTAEIREEFPSWEHLSFLKSSNKNNKFLAMFNLSNCLDNDTKFTLHHLRIFKCLITGKDC

Molecular Formula

59088 (Gene_ID) P33580 (I32-C239) (Accession)

Molecular Weight

Approximately 24 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Calhm2 shRNA (UAS) - Lentiviral mouse Calhm2 shRNA (UAS, RFP) plasmid
GTR15168481 1 Vial

Lentiviral mouse Calhm2 shRNA (UAS) - Lentiviral mouse Calhm2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
CREB5 (NM_182899) Human Tagged ORF Clone Lentiviral Particle
RC218321L4V 200 µL

CREB5 (NM_182899) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
E2F1 Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-61369R-BF647-01 20 µL

E2F1 Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
E2F1 Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-61369R-BF647-02 100 µL

E2F1 Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
APR3
MBS8565436-01 0.1 mL

APR3

Sign In for Pricing
View Details
APR3
MBS8565436-02 0.1 mL (AF405L)

APR3

Sign In for Pricing
View Details