PDGF-BB, Human (P.pastoris)
PDGF-BB Protein, Human (P.pastoris) is the most active PDGF isoform, binds to PDGF receptor, promotes diverse cell types proliferation and osteogenesis, and further stimulates bone formation in fracture or defect.
Product Specifications
Product Name Alternative
PDGF-BB Protein, Human (P.pastoris), Human, P. pastoris
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/pdgf-bb-protein-human-p-pastoris.html
Purity
97.00
Smiles
SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
Molecular Formula
5155 (Gene_ID) P01127-1 (S82-T190) (Accession)
Molecular Weight
Approximately 24.3 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Sun H, et al. Recombinant human platelet-derived growth factor-BB versus autologous bone graft in foot and ankle fusion: A systematic review and meta-analysis. Foot Ankle Surg. 2017 Mar;23 (1) :32-39.|[2]Solchaga LA, et al. Comparison of the effect of intra-tendon applications of recombinant human platelet-derived growth factor-BB, platelet-rich plasma, steroids in a rat achilles tendon collagenase model. J Orthop Res. 2014 Jan;32 (1) :145-50.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A01694-1-HRP 100 µg/Vial
Anti-RNF43 Antibody Picoband® (HRP Conjugate)
Sign In for Pricing
View Details 
