Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-BB, Human (P.pastoris)

PDGF-BB Protein, Human (P.pastoris) is the most active PDGF isoform, binds to PDGF receptor, promotes diverse cell types proliferation and osteogenesis, and further stimulates bone formation in fracture or defect.

Product Specifications

Product Name Alternative

PDGF-BB Protein, Human (P.pastoris), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-bb-protein-human-p-pastoris.html

Purity

97.00

Smiles

SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT

Molecular Formula

5155 (Gene_ID) P01127-1 (S82-T190) (Accession)

Molecular Weight

Approximately 24.3 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Sun H, et al. Recombinant human platelet-derived growth factor-BB versus autologous bone graft in foot and ankle fusion: A systematic review and meta-analysis. Foot Ankle Surg. 2017 Mar;23 (1) :32-39.|[2]Solchaga LA, et al. Comparison of the effect of intra-tendon applications of recombinant human platelet-derived growth factor-BB, platelet-rich plasma, steroids in a rat achilles tendon collagenase model. J Orthop Res. 2014 Jan;32 (1) :145-50.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXR2 Antibody, FITC conjugated
A58914-100UG 100 µg

FOXR2 Antibody, FITC conjugated

Sign In for Pricing
View Details
PACSIN3 Protein Vector (Human) (pPM-C-His)
PV029908 500 ng

PACSIN3 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
MGC50722 (NM_203348) Human Tagged Lenti ORF Clone
RC208164L4 10 µg

MGC50722 (NM_203348) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-Zebrafish CKBa/b Antibody Picoband® Cy3 Conjugated
AZA0A8M6Z2B4-Cy3 100 µg/Vial

Anti-Zebrafish CKBa/b Antibody Picoband® Cy3 Conjugated

Sign In for Pricing
View Details
WEEV Spike glycoprotein E1 ELISA Kit
KVV34402 96 Tests

WEEV Spike glycoprotein E1 ELISA Kit

Sign In for Pricing
View Details
Dishevelled 3 Antibody [J9L3]
F3986-20uL 20 µL

Dishevelled 3 Antibody [J9L3]

Sign In for Pricing
View Details