Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLF14 Rabbit Polyclonal Antibody

Rabbit polyclonal antibody to KLF14

Product Specifications

Product Name Alternative

BTEB5

UniProt

Q8TD94

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KLF14

Target

KLF14

Clonality

Polyclonal

Conjugation

Unconjugated

Sequence

Synthetic peptide located within the following region: SAAVACLDYFAAECLVSMSAGAVVHRRPPDPEGAGGAAGSEVGAAHPESA

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Concentration

0.5 mg/ml

Form

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Molecular Weight

33kDa

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Prediction Reactivity

Canine, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_619638

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCL3 (C C Motif Chemokine 3, CCL 3, CCL3_HUMAN, Chemokine C C Motif Ligand 3, Chemokine CC Motif Ligand 3, G0/G1 Switch Regulatory Protein 19 1, G0/G1 Switch Regulatory Protein 19-1, G0S19 1, G0S19 1 Protein, Heparin Binding Chemotaxis Protein, L2G25B, LD78 alpha, LD78-alpha (4-69), LD78ALPHA, Macrophage Inflammatory Protein 1 alpha, Macrophage Inflammatory Protein 1-alpha, MIP 1 alpha, MIP 1A, MIP-1-alpha, MIP-1-alpha (4-69), MIP1A, PAT 464.1, SCYA 3, SCYA3, SIS alpha, SIS beta, SIS-beta, Small Inducible Cytokine A3, Small-inducible Cytokine A3, Tonsillar Lymphocyte LD78 alpha Protein) (APC) discontinued
303194-APC 100 µL

CCL3 (C C Motif Chemokine 3, CCL 3, CCL3_HUMAN, Chemokine C C Motif Ligand 3, Chemokine CC Motif Ligand 3, G0/G1 Switch Regulatory Protein 19 1, G0/G1 Switch Regulatory Protein 19-1, G0S19 1, G0S19 1 Protein, Heparin Binding Chemotaxis Protein, L2G25B, LD78 alpha, LD78-alpha (4-69), LD78ALPHA, Macrophage Inflammatory Protein 1 alpha, Macrophage Inflammatory Protein 1-alpha, MIP 1 alpha, MIP 1A, MIP-1-alpha, MIP-1-alpha (4-69), MIP1A, PAT 464.1, SCYA 3, SCYA3, SIS alpha, SIS beta, SIS-beta, Small Inducible Cytokine A3, Small-inducible Cytokine A3, Tonsillar Lymphocyte LD78 alpha Protein) (APC) discontinued

Sign In for Pricing
View Details
Human ASS1 ELISA Kit
E003635 1 Each

Human ASS1 ELISA Kit

Sign In for Pricing
View Details
CD239 Polyclonal Antibody
UB-GEN-13822 100 µL

CD239 Polyclonal Antibody

Sign In for Pricing
View Details
Rab9/RAB9A Rabbit Polyclonal Antibody (FITC)
orb2604990 100 µg

Rab9/RAB9A Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Recombinant Salmonella heidelberg Spermidine export protein MdtI (mdtI)
MBS7020139-01 0.02 mg

Recombinant Salmonella heidelberg Spermidine export protein MdtI (mdtI)

Sign In for Pricing
View Details
Recombinant Salmonella heidelberg Spermidine export protein MdtI (mdtI)
MBS7020139-02 0.1 mg

Recombinant Salmonella heidelberg Spermidine export protein MdtI (mdtI)

Sign In for Pricing
View Details