GLP-1 (7-36), amide, chicken, common turkey
Product Specifications
Bioactivity
GLP-1 (7-36), amide, chicken, common turkey is a polypeptide molecule with the sequence HAEGTYTSDITSYLEGQAAKEFIAWLVNGR-NH2.
Smiles
[H]N[C@@H](CC1=CN=CN1)C(N[C@@H](C)C(N[C@H](C(NCC(N[C@]([H])(C(N[C@@H](CC2=CC=C(C=C2)O)C(N[C@]([H])(C(N[C@H](C(N[C@@H](CC(O)=O)C(N[C@]([H])(C(N[C@]([H])(C(N[C@H](C(N[C@@H](CC3=CC=C(C=C3)O)C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(N[C@@H](C)C(N[C@@H](C)C(N[C@H](C(N[C@H](C(N[C@@H](CC4=CC=CC=C4)C(N[C@]([H])(C(N[C@@H](C)C(N[C@@H](CC5=CNC6=C5C=CC=C6)C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(N)=O)CCCNC(N)=N)=O)=O)CC(N)=O)=O)C(C)C)=O)CC(C)C)=O)=O)=O)[C@@H](C)CC)=O)=O)CCC(O)=O)=O)CCCCN)=O)=O)=O)CCC(N)=O)=O)=O)CCC(O)=O)=O)CC(C)C)=O)=O)CO)=O)[C@H](O)C)=O)[C@@H](C)CC)=O)=O)CO)=O)[C@H](O)C)=O)=O)[C@H](O)C)=O)=O)CCC(O)=O)=O)=O
Molecular Formula
C149H224N40O47
Molecular Weight
3327.61
Shipping Conditions
Ice Packs
Storage Temperature
-20°C
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC402397-100 1x 100 µL
CD14 (Monocyte / Macrophage Marker) (LPSR/2397), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB1076-100 1x 100 µL
Cytokeratin, HMW (KRTH/1076), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
PKSH030573 100 µg
Recombinant Human Galactolipase/PLRP2 Protein (His Tag)
Sign In for Pricing
View Details