Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Ubiquitin-conjugating enzyme E2 1 (UBC1)

Product Specifications

Product Name Alternative

(E2 ubiquitin-conjugating enzyme 1) (Ubiquitin carrier protein 1) (Ubiquitin-conjugating enzyme E2-17 kDa 1) (Ubiquitin-protein ligase 1)

Abbreviation

Recombinant Mouse-ear cress UBC1 protein

Gene Name

UBC1

UniProt

P25865

Expression Region

1-152aa

Organism

Arabidopsis thaliana (Mouse-ear cress)

Target Sequence

MSTPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMYSESKREYNRRVRDVVEQSWTAD

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

24.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMG2 Mouse Monoclonal Antibody [Clone ID: OTI1E8]
CF808168 100 µg

PSMG2 Mouse Monoclonal Antibody [Clone ID: OTI1E8]

Sign In for Pricing
View Details
Barium Chloride Dihydrate 99% Extrapure
0337A 01000 1 Kg

Barium Chloride Dihydrate 99% Extrapure

Sign In for Pricing
View Details
Rabbit Anti-ENPP1 antibody
SL1760R-01 50 µL

Rabbit Anti-ENPP1 antibody

Sign In for Pricing
View Details
Rabbit Anti-ENPP1 antibody
SL1760R-02 100 µL

Rabbit Anti-ENPP1 antibody

Sign In for Pricing
View Details
BML277 Acid
MBS5811714 Inquire

BML277 Acid

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung: left upper lobe
CS502363 5x 5 µm

Frozen Tissue Sections, Lung: left upper lobe

Sign In for Pricing
View Details