Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCN7A Rabbit Polyclonal Antibody

Rabbit polyclonal antibody to SCN7A

Product Specifications

Product Name Alternative

NaG, SCN6A, Nav2.1, Nav2.2

UniProt

Q01118

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human SCN7A

Target

SCN7A

Clonality

Polyclonal

Conjugation

Unconjugated

Sequence

Synthetic peptide located within the following region: PFIYGNLSQGMVSEPLEDVDPYYYKKKNTFIVLNKNRTIFRFNAASILCT

Field of Research

Epigenetics

Purification

Affinity Purified

Concentration

0.5 mg/ml

Form

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Molecular Weight

83kDa

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_002967.2

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Monkey CD40 Protein, His-tagged, Alexa Fluor 647 conjugated
CD40-8824CAF647 20 μg- 50 μg- 100 μg

Recombinant Monkey CD40 Protein, His-tagged, Alexa Fluor 647 conjugated

Sign In for Pricing
View Details
DHX40 Rabbit Polyclonal Antibody (Cy3)
orb3129727 100 µg

DHX40 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Gm5142 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
22079124 3x 1.0µg DNA

Gm5142 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
ITCH, ID (ITCH, E3 ubiquitin-protein ligase Itchy homolog, Atrophin-1-interacting protein 4, NFE2-associated polypeptide 1) (Azide free) (HRP) discontinued
037130-HRP 200 µL

ITCH, ID (ITCH, E3 ubiquitin-protein ligase Itchy homolog, Atrophin-1-interacting protein 4, NFE2-associated polypeptide 1) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Tumor Necrosis Factor Receptor 1, p55/p60 (TNFR 1, TNFR1, TNF-R1, TNF-R, Tumor Necrosis Factor Receptor Type I, TNFR-I, TNF-RI, TNF-R-I, CD120a, FPF, MGC19588, p55, p55-R, p60, TBP1, TNFR55, TNF-R55, TNFR60, Tumor Necrosis Factor alpha Receptor, TNFAR, Tu
MBS609469-01 1 mL

Tumor Necrosis Factor Receptor 1, p55/p60 (TNFR 1, TNFR1, TNF-R1, TNF-R, Tumor Necrosis Factor Receptor Type I, TNFR-I, TNF-RI, TNF-R-I, CD120a, FPF, MGC19588, p55, p55-R, p60, TBP1, TNFR55, TNF-R55, TNFR60, Tumor Necrosis Factor alpha Receptor, TNFAR, Tu

Sign In for Pricing
View Details
Tumor Necrosis Factor Receptor 1, p55/p60 (TNFR 1, TNFR1, TNF-R1, TNF-R, Tumor Necrosis Factor Receptor Type I, TNFR-I, TNF-RI, TNF-R-I, CD120a, FPF, MGC19588, p55, p55-R, p60, TBP1, TNFR55, TNF-R55, TNFR60, Tumor Necrosis Factor alpha Receptor, TNFAR, Tu
MBS609469-02 5x 1 mL

Tumor Necrosis Factor Receptor 1, p55/p60 (TNFR 1, TNFR1, TNF-R1, TNF-R, Tumor Necrosis Factor Receptor Type I, TNFR-I, TNF-RI, TNF-R-I, CD120a, FPF, MGC19588, p55, p55-R, p60, TBP1, TNFR55, TNF-R55, TNFR60, Tumor Necrosis Factor alpha Receptor, TNFAR, Tu

Sign In for Pricing
View Details