Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leukocyte surface antigen CD47 (CD47), partial, Biotinylated

Product Specifications

Product Name Alternative

(Antigenic surface determinant protein OA3) (Integrin-associated protein) (IAP) (Protein MER6) (CD antigen CD47)

Abbreviation

Recombinant Human CD47 protein, partial, Biotinylated

Gene Name

CD47

UniProt

Q08722

Expression Region

19-139aa

Organism

Homo sapiens (Human)

Target Sequence

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

Tag

C-terminal hFc1-Avi-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus. Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

43.3 kDa

References & Citations

"Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S. Nat. Genet. 36:40-45 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GCDFP15 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-4726R-BF405 100 µL

GCDFP15 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Ask
View Details
ZBTB8OS CRISPRa sgRNA lentivector (set of three targets)(Mouse)
50727124 3x 1.0µg DNA

ZBTB8OS CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Ask
View Details
Profilin 2 (PFN2) Antibody (Biotin)
abx272371-01 200 µL

Profilin 2 (PFN2) Antibody (Biotin)

Ask
View Details
Profilin 2 (PFN2) Antibody (Biotin)
abx272371-02 1 mL

Profilin 2 (PFN2) Antibody (Biotin)

Ask
View Details
RTN4IP1 (41-396, His-tag) Human Protein
AR50185PU-S 100 µg

RTN4IP1 (41-396, His-tag) Human Protein

Ask
View Details