Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Anti-PGGT1B Polyclonal Antibody

Product Specifications

Bioactivity

Anti-PGGT1B Polyclonal Antibody is a Rabbit antibody targeting PGGT1B. Anti-PGGT1B Polyclonal Antibody can be used in WB.

Shipping Conditions

Cool pack

Storage Temperature

-20°C

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pla2g12a Mouse Gene Knockout Kit (CRISPR)
KN513377 1 Kit

Pla2g12a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CLHC1 (NM_001135598) Human Tagged ORF Clone Lentiviral Particle
RC226767L3V 200 µL

CLHC1 (NM_001135598) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
HY-P1229-01 5 mg

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
HY-P1229-02 10 mg

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details
HNF3beta/FOXA2 Rabbit mAb
MBS9147160-01 0.02 mL

HNF3beta/FOXA2 Rabbit mAb

Sign In for Pricing
View Details
HNF3beta/FOXA2 Rabbit mAb
MBS9147160-02 0.1 mL

HNF3beta/FOXA2 Rabbit mAb

Sign In for Pricing
View Details