Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Anti-5T4 Polyclonal Antibody

Product Specifications

Bioactivity

Anti-5T4 Polyclonal Antibody is a Rabbit antibody targeting 5T4. Anti-5T4 Polyclonal Antibody can be used in WB.

Shipping Conditions

Ice Packs

Storage Temperature

-20°C

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
HY-P1229-01 5 mg

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
HY-P1229-02 10 mg

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details
Csnk1g3 AAV siRNA Pooled Vector
16948164 1.0 µg

Csnk1g3 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
ML251
BA2115-25 25 mg

ML251

Sign In for Pricing
View Details
HBP1 (NM_012257) Human Tagged Lenti ORF Clone
RC202260L4 10 µg

HBP1 (NM_012257) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
FAS (Y291) Antibody Blocking peptide
orb1458156 500 µg

FAS (Y291) Antibody Blocking peptide

Sign In for Pricing
View Details