Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD47, Rat (HEK293, His)

The CD47 protein acts as a THBS1 receptor and regulates integrin signaling, promoting cell-cell interactions. It plays a role in signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, immune regulation, and memory formation. CD47 Protein, Rat (HEK293, His) is the recombinant rat-derived CD47 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD47 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd47-protein-rat-hek293-his.html

Purity

95.00

Smiles

QLLLSKVKSVEFTSCNDTVVIPCKVLNVEAQSTDEMFVKWKLNKSYIFIYDGNKNSTTREQNFTSAKISVSDLLKGIASLTMDTHEAVVGNYTCEVTELSREGKTVIELKNRPVSWFSTNEK

Molecular Formula

29364 (Gene_ID) P97829-1 (Q19-K140) (Accession)

Molecular Weight

The protein migrates as an approximately 23-40 kDa band under reducing SDS-PAGE due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MOG Recombinant Rabbit Monoclonal Antibody (Biotin)
orb2349811 100 µL

MOG Recombinant Rabbit Monoclonal Antibody (Biotin)

Sign In for Pricing
View Details
Robo1 3'UTR Luciferase Stable Cell Line
TU219575 1.0 mL

Robo1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Goat leukocyte antigen A (HLA-A) ELISA Kit
MBS265817-01 48 Well

Goat leukocyte antigen A (HLA-A) ELISA Kit

Sign In for Pricing
View Details
Goat leukocyte antigen A (HLA-A) ELISA Kit
MBS265817-02 96 Well

Goat leukocyte antigen A (HLA-A) ELISA Kit

Sign In for Pricing
View Details
Goat leukocyte antigen A (HLA-A) ELISA Kit
MBS265817-03 5x 96 Well

Goat leukocyte antigen A (HLA-A) ELISA Kit

Sign In for Pricing
View Details
Goat leukocyte antigen A (HLA-A) ELISA Kit
MBS265817-04 10x 96 Well

Goat leukocyte antigen A (HLA-A) ELISA Kit

Sign In for Pricing
View Details