Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD20/MS4A1, Human (Trx-His)

CD20/MS4A1 protein is a B lymphocyte membrane protein that plays a crucial regulatory role in cellular calcium influx, which is essential for the development, differentiation and activation of B lymphocytes. As part of a store-operated calcium (SOC) channel, it promotes calcium influx upon B cell receptor/BCR activation. CD20/MS4A1 Protein, Human (Trx-His) is the recombinant human-derived CD20/MS4A1 protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.

Product Specifications

Product Name Alternative

CD20/MS4A1 Protein, Human (Trx-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd20-ms4a1-protein-human-trx-his.html

Purity

98.00

Smiles

IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQS

Molecular Formula

931 (Gene_ID) P11836-1 (I141-S188) (Accession)

Molecular Weight

Approximately 20.91 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HUS1B Recombinant Protein (Rat)
RP205361 100 µg

HUS1B Recombinant Protein (Rat)

Sign In for Pricing
View Details
Mouse Monoclonal CUGBP1/CELF1 Antibody (OTI5B8) [Janelia Fluor 646]
NBP2-71623JF646 0.1 mL

Mouse Monoclonal CUGBP1/CELF1 Antibody (OTI5B8) [Janelia Fluor 646]

Sign In for Pricing
View Details
Ethyl (6-Amino-2,3,4-trichlorobenzyl)glycinate
TRC-A647410-250MG 250 mg

Ethyl (6-Amino-2,3,4-trichlorobenzyl)glycinate

Sign In for Pricing
View Details
Mouse CXCL10 ELISA Kit
CEK1443 96 Tests

Mouse CXCL10 ELISA Kit

Sign In for Pricing
View Details
Rel- (2R,3S,4R,5S) -3- (3-Chloro-2-fluorophenyl) -4- (4-chloro-2-fluorophenyl) -4-cyano-5- (2,2-dimethylpropyl) pyrrolidine-2-carboxylic acid tert-butyl ester
HY-78745-01 25 mg

Rel- (2R,3S,4R,5S) -3- (3-Chloro-2-fluorophenyl) -4- (4-chloro-2-fluorophenyl) -4-cyano-5- (2,2-dimethylpropyl) pyrrolidine-2-carboxylic acid tert-butyl ester

Sign In for Pricing
View Details
Rel- (2R,3S,4R,5S) -3- (3-Chloro-2-fluorophenyl) -4- (4-chloro-2-fluorophenyl) -4-cyano-5- (2,2-dimethylpropyl) pyrrolidine-2-carboxylic acid tert-butyl ester
HY-78745-02 50 mg

Rel- (2R,3S,4R,5S) -3- (3-Chloro-2-fluorophenyl) -4- (4-chloro-2-fluorophenyl) -4-cyano-5- (2,2-dimethylpropyl) pyrrolidine-2-carboxylic acid tert-butyl ester

Sign In for Pricing
View Details