Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD20/MS4A1, Human (Trx-His)

CD20/MS4A1 protein is a B lymphocyte membrane protein that plays a crucial regulatory role in cellular calcium influx, which is essential for the development, differentiation and activation of B lymphocytes. As part of a store-operated calcium (SOC) channel, it promotes calcium influx upon B cell receptor/BCR activation. CD20/MS4A1 Protein, Human (Trx-His) is the recombinant human-derived CD20/MS4A1 protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.

Product Specifications

Product Name Alternative

CD20/MS4A1 Protein, Human (Trx-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd20-ms4a1-protein-human-trx-his.html

Purity

98.00

Smiles

IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQS

Molecular Formula

931 (Gene_ID) P11836-1 (I141-S188) (Accession)

Molecular Weight

Approximately 20.91 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C6orf138 (PTCHD4) (NM_001013732) Human Tagged ORF Clone
RC218697 10 µg

C6orf138 (PTCHD4) (NM_001013732) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit 6-OHDA ELISA Kit
ERTA0690 96 Tests

Rabbit 6-OHDA ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal PBX2 Antibody
NBP2-31853 0.1 mL

Rabbit Polyclonal PBX2 Antibody

Sign In for Pricing
View Details
GAPDHP53 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV762022 1.0 µg DNA

GAPDHP53 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Vasohibin 1 antibody
70R-3105 50 ug

Vasohibin 1 antibody

Sign In for Pricing
View Details
Olfr73 Mouse shRNA Plasmid (Locus ID 117004)
TR515553 1 Kit

Olfr73 Mouse shRNA Plasmid (Locus ID 117004)

Sign In for Pricing
View Details