Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD20/MS4A1, Human (Trx-His)

CD20/MS4A1 protein is a B lymphocyte membrane protein that plays a crucial regulatory role in cellular calcium influx, which is essential for the development, differentiation and activation of B lymphocytes. As part of a store-operated calcium (SOC) channel, it promotes calcium influx upon B cell receptor/BCR activation. CD20/MS4A1 Protein, Human (Trx-His) is the recombinant human-derived CD20/MS4A1 protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.

Product Specifications

Product Name Alternative

CD20/MS4A1 Protein, Human (Trx-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd20-ms4a1-protein-human-trx-his.html

Purity

98.00

Smiles

IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQS

Molecular Formula

931 (Gene_ID) P11836-1 (I141-S188) (Accession)

Molecular Weight

Approximately 20.91 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ring1 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3946603 1.0 µg DNA

Ring1 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Rsph4a Mouse Gene Knockout Kit (CRISPR)
KN515166 1 Kit

Rsph4a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Monoclonal EEA1 Antibody (GT10811)
NBP3-13599 100 µL

Mouse Monoclonal EEA1 Antibody (GT10811)

Sign In for Pricing
View Details
Rat Monoclonal Endoglin/CD105 Antibody (MJ7/18) [Alexa Fluor 488]
NB100-77666AF488 0.5 mL

Rat Monoclonal Endoglin/CD105 Antibody (MJ7/18) [Alexa Fluor 488]

Sign In for Pricing
View Details
Frataxin Overexpression Lysate (Native) - (Dry Ice)
NBL1-10871 0.1 mg

Frataxin Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Thiodiglycol
M10422-01 1 g

Thiodiglycol

Sign In for Pricing
View Details