Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD20/MS4A1, Human (Trx-His)

CD20/MS4A1 protein is a B lymphocyte membrane protein that plays a crucial regulatory role in cellular calcium influx, which is essential for the development, differentiation and activation of B lymphocytes. As part of a store-operated calcium (SOC) channel, it promotes calcium influx upon B cell receptor/BCR activation. CD20/MS4A1 Protein, Human (Trx-His) is the recombinant human-derived CD20/MS4A1 protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.

Product Specifications

Product Name Alternative

CD20/MS4A1 Protein, Human (Trx-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd20-ms4a1-protein-human-trx-his.html

Purity

98.00

Smiles

IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQS

Molecular Formula

931 (Gene_ID) P11836-1 (I141-S188) (Accession)

Molecular Weight

Approximately 20.91 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Napsin A Antibody (rNAPSA/1239) [Allophycocyanin]
NBP3-08374APC 0.1 mL

Mouse Monoclonal Napsin A Antibody (rNAPSA/1239) [Allophycocyanin]

Sign In for Pricing
View Details
Rat Chst9 Pre-designed siRNA Set A
SI202757A 1 Each

Rat Chst9 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Mouse Ier5 qPCR Primer Pair
QM15226S 200 Tests

Mouse Ier5 qPCR Primer Pair

Sign In for Pricing
View Details
Pig Pinosylvin (PS) Protein
abx651591-01 1 mg

Pig Pinosylvin (PS) Protein

Sign In for Pricing
View Details
Pig Pinosylvin (PS) Protein
abx651591-02 5 mg

Pig Pinosylvin (PS) Protein

Sign In for Pricing
View Details
Rabbit Polyclonal Pax2 Antibody [DyLight 405]
NBP2-99013V 0.1 mL

Rabbit Polyclonal Pax2 Antibody [DyLight 405]

Sign In for Pricing
View Details