Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD20/MS4A1, Human (Trx-His)

CD20/MS4A1 protein is a B lymphocyte membrane protein that plays a crucial regulatory role in cellular calcium influx, which is essential for the development, differentiation and activation of B lymphocytes. As part of a store-operated calcium (SOC) channel, it promotes calcium influx upon B cell receptor/BCR activation. CD20/MS4A1 Protein, Human (Trx-His) is the recombinant human-derived CD20/MS4A1 protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.

Product Specifications

Product Name Alternative

CD20/MS4A1 Protein, Human (Trx-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd20-ms4a1-protein-human-trx-his.html

Purity

98.00

Smiles

IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQS

Molecular Formula

931 (Gene_ID) P11836-1 (I141-S188) (Accession)

Molecular Weight

Approximately 20.91 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC10A5 shRNA Plasmid (m)
sc-153486-SH 20 µg

SLC10A5 shRNA Plasmid (m)

Sign In for Pricing
View Details
Recombinant Human CD152/CTLA4 Protein, His Tag
KMH325 50 µg

Recombinant Human CD152/CTLA4 Protein, His Tag

Sign In for Pricing
View Details
CBR4 (Carbonyl Reductase Family Member 4, 3-oxoacyl-[acyl-carrier-protein] Reductase, Quinone Reductase CBR4, FLJ14431) (Biotin)
124398-Biotin 100 µL

CBR4 (Carbonyl Reductase Family Member 4, 3-oxoacyl-[acyl-carrier-protein] Reductase, Quinone Reductase CBR4, FLJ14431) (Biotin)

Sign In for Pricing
View Details
Recombinant Human ETS1 associated protein II Protein
NBP2-22913 0.05 mg

Recombinant Human ETS1 associated protein II Protein

Sign In for Pricing
View Details
SFN (Stratifin, YWHAS) (Biotin)
251557-Biotin 100 µL

SFN (Stratifin, YWHAS) (Biotin)

Sign In for Pricing
View Details
Clindamycin 50mg
A16459-50 50 mg

Clindamycin 50mg

Sign In for Pricing
View Details