Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD20/MS4A1, Human (Trx-His)

CD20/MS4A1 protein is a B lymphocyte membrane protein that plays a crucial regulatory role in cellular calcium influx, which is essential for the development, differentiation and activation of B lymphocytes. As part of a store-operated calcium (SOC) channel, it promotes calcium influx upon B cell receptor/BCR activation. CD20/MS4A1 Protein, Human (Trx-His) is the recombinant human-derived CD20/MS4A1 protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.

Product Specifications

Product Name Alternative

CD20/MS4A1 Protein, Human (Trx-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd20-ms4a1-protein-human-trx-his.html

Purity

98.00

Smiles

IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQS

Molecular Formula

931 (Gene_ID) P11836-1 (I141-S188) (Accession)

Molecular Weight

Approximately 20.91 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MKK4/MEK4 Recombinant Protein Antigen
NBP2-57194PEP 100 µL

MKK4/MEK4 Recombinant Protein Antigen

Sign In for Pricing
View Details
KChIP2 (KCNIP2) (NM_173195) Human Tagged ORF Clone
RC212555 10 µg

KChIP2 (KCNIP2) (NM_173195) Human Tagged ORF Clone

Sign In for Pricing
View Details
Bromodeoxyuridine (BrdU) (MaxLight 550)
MBS6215685-01 0.1 mL

Bromodeoxyuridine (BrdU) (MaxLight 550)

Sign In for Pricing
View Details
Bromodeoxyuridine (BrdU) (MaxLight 550)
MBS6215685-02 5x 0.1 mL

Bromodeoxyuridine (BrdU) (MaxLight 550)

Sign In for Pricing
View Details
NTSR1 Protein (C-Flag Tag, )
P511945 100 µg

NTSR1 Protein (C-Flag Tag, )

Sign In for Pricing
View Details
pET-21(+) Plasmid
PVTY00877 2 µg

pET-21(+) Plasmid

Sign In for Pricing
View Details