Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD20/MS4A1, Human (Trx-His)

CD20/MS4A1 protein is a B lymphocyte membrane protein that plays a crucial regulatory role in cellular calcium influx, which is essential for the development, differentiation and activation of B lymphocytes. As part of a store-operated calcium (SOC) channel, it promotes calcium influx upon B cell receptor/BCR activation. CD20/MS4A1 Protein, Human (Trx-His) is the recombinant human-derived CD20/MS4A1 protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.

Product Specifications

Product Name Alternative

CD20/MS4A1 Protein, Human (Trx-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd20-ms4a1-protein-human-trx-his.html

Purity

98.00

Smiles

IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQS

Molecular Formula

931 (Gene_ID) P11836-1 (I141-S188) (Accession)

Molecular Weight

Approximately 20.91 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Membrane Protein Human RNF223 (Ring finger protein 223) Full Length
MPC4835K Each

Magic™ Membrane Protein Human RNF223 (Ring finger protein 223) Full Length

Sign In for Pricing
View Details
Human DAND5 Knockout A549 cell line
GTR15403511 1 Vial

Human DAND5 Knockout A549 cell line

Sign In for Pricing
View Details
DDIT3 rabbit polyclonal antibody, Purified
AP22879PU-N 50 µg

DDIT3 rabbit polyclonal antibody, Purified

Sign In for Pricing
View Details
Complement C1s Subcomponent (C1S) Antibody
abx377515-01 50 µg

Complement C1s Subcomponent (C1S) Antibody

Sign In for Pricing
View Details
Complement C1s Subcomponent (C1S) Antibody
abx377515-02 100 µg

Complement C1s Subcomponent (C1S) Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal EpCAM/TROP1 Antibody (EGP40/1556R) [Janelia Fluor 549]
NBP2-54425JF549 0.1 mL

Rabbit Monoclonal EpCAM/TROP1 Antibody (EGP40/1556R) [Janelia Fluor 549]

Sign In for Pricing
View Details