Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD20/MS4A1, Human (Trx-His)

CD20/MS4A1 protein is a B lymphocyte membrane protein that plays a crucial regulatory role in cellular calcium influx, which is essential for the development, differentiation and activation of B lymphocytes. As part of a store-operated calcium (SOC) channel, it promotes calcium influx upon B cell receptor/BCR activation. CD20/MS4A1 Protein, Human (Trx-His) is the recombinant human-derived CD20/MS4A1 protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.

Product Specifications

Product Name Alternative

CD20/MS4A1 Protein, Human (Trx-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd20-ms4a1-protein-human-trx-his.html

Purity

98.00

Smiles

IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQS

Molecular Formula

931 (Gene_ID) P11836-1 (I141-S188) (Accession)

Molecular Weight

Approximately 20.91 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Xenopus laevis GPI inositol-deacylase (pgap1), partial
MBS7084568 Inquire

Recombinant Xenopus laevis GPI inositol-deacylase (pgap1), partial

Sign In for Pricing
View Details
BHK-21 Cell Line
RWT-173 1x 10^6

BHK-21 Cell Line

Sign In for Pricing
View Details
DREAM Polyclonal Antibody
UB-GEN-15827 100 µL

DREAM Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Ajellomyces capsulata Assembly factor CBP4 (CBP4), partial
MBS7064920 Inquire

Recombinant Ajellomyces capsulata Assembly factor CBP4 (CBP4), partial

Sign In for Pricing
View Details
Anti-JIP1 antibody
PAab04437 100 µg

Anti-JIP1 antibody

Sign In for Pricing
View Details
Rat typeI procollagen (PC I) ELISA Kit
YLA0133RA-01 48 Tests

Rat typeI procollagen (PC I) ELISA Kit

Sign In for Pricing
View Details