Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD20/MS4A1, Human (Trx-His)

CD20/MS4A1 protein is a B lymphocyte membrane protein that plays a crucial regulatory role in cellular calcium influx, which is essential for the development, differentiation and activation of B lymphocytes. As part of a store-operated calcium (SOC) channel, it promotes calcium influx upon B cell receptor/BCR activation. CD20/MS4A1 Protein, Human (Trx-His) is the recombinant human-derived CD20/MS4A1 protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.

Product Specifications

Product Name Alternative

CD20/MS4A1 Protein, Human (Trx-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd20-ms4a1-protein-human-trx-his.html

Purity

98.00

Smiles

IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQS

Molecular Formula

931 (Gene_ID) P11836-1 (I141-S188) (Accession)

Molecular Weight

Approximately 20.91 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human N-Acetylglucosaminyltransferase1/MGAT1 CF
8334-GT-025 25 µg

Recombinant Human N-Acetylglucosaminyltransferase1/MGAT1 CF

Sign In for Pricing
View Details
C8orf33 sgRNA CRISPR Lentivector set (Human)
K0259801 3x 1.0 µg

C8orf33 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
MAS1
323250-01 50 µL

MAS1

Sign In for Pricing
View Details
MAS1
323250-02 100 µL

MAS1

Sign In for Pricing
View Details
PE/Fire™ 640 anti-mouse CD279 (PD-1)
GT03969 25 µg

PE/Fire™ 640 anti-mouse CD279 (PD-1)

Sign In for Pricing
View Details
Rabbit Monoclonal UCH-L3 Antibody (153) [mFluor Violet 500 SE]
NBP2-90679MFV500 0.1 mL

Rabbit Monoclonal UCH-L3 Antibody (153) [mFluor Violet 500 SE]

Sign In for Pricing
View Details