CD20/MS4A1, Human (Trx-His)
CD20/MS4A1 protein is a B lymphocyte membrane protein that plays a crucial regulatory role in cellular calcium influx, which is essential for the development, differentiation and activation of B lymphocytes. As part of a store-operated calcium (SOC) channel, it promotes calcium influx upon B cell receptor/BCR activation. CD20/MS4A1 Protein, Human (Trx-His) is the recombinant human-derived CD20/MS4A1 protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.
Product Specifications
Product Name Alternative
CD20/MS4A1 Protein, Human (Trx-His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd20-ms4a1-protein-human-trx-his.html
Purity
98.00
Smiles
IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQS
Molecular Formula
931 (Gene_ID) P11836-1 (I141-S188) (Accession)
Molecular Weight
Approximately 20.91 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Human TNFRSF1B (Tumor Necrosis Factor Receptor Superfamily, Member 1B) ELISA Kit
Human TNFRSF1B (Tumor Necrosis Factor Receptor Superfamily, Member 1B) ELISA Kit
Human TNFRSF1B (Tumor Necrosis Factor Receptor Superfamily, Member 1B) ELISA Kit
Cy3-Linked Polyclonal Antibody to Protein Disulfide Isomerase (PDI)
Cy3-Linked Polyclonal Antibody to Protein Disulfide Isomerase (PDI)