Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD20/MS4A1, Human (Trx-His)

CD20/MS4A1 protein is a B lymphocyte membrane protein that plays a crucial regulatory role in cellular calcium influx, which is essential for the development, differentiation and activation of B lymphocytes. As part of a store-operated calcium (SOC) channel, it promotes calcium influx upon B cell receptor/BCR activation. CD20/MS4A1 Protein, Human (Trx-His) is the recombinant human-derived CD20/MS4A1 protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.

Product Specifications

Product Name Alternative

CD20/MS4A1 Protein, Human (Trx-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd20-ms4a1-protein-human-trx-his.html

Purity

98.00

Smiles

IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQS

Molecular Formula

931 (Gene_ID) P11836-1 (I141-S188) (Accession)

Molecular Weight

Approximately 20.91 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-p38 MAPK (Thr180) Antibody
AF3457-01 100 µL

Phospho-p38 MAPK (Thr180) Antibody

Sign In for Pricing
View Details
Phospho-p38 MAPK (Thr180) Antibody
AF3457-02 200 µL

Phospho-p38 MAPK (Thr180) Antibody

Sign In for Pricing
View Details
Nrros Rat siRNA Oligo Duplex (Locus ID 303875)
SR503743 1 Kit

Nrros Rat siRNA Oligo Duplex (Locus ID 303875)

Sign In for Pricing
View Details
SPRR3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2280305 3x 1.0 µg

SPRR3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
MED22 Rabbit Polyclonal Antibody
E28PN0842 100 µL

MED22 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Protocatechuic Acid
300830 20 mg

Protocatechuic Acid

Sign In for Pricing
View Details