Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD20/MS4A1, Human (Trx-His)

CD20/MS4A1 protein is a B lymphocyte membrane protein that plays a crucial regulatory role in cellular calcium influx, which is essential for the development, differentiation and activation of B lymphocytes. As part of a store-operated calcium (SOC) channel, it promotes calcium influx upon B cell receptor/BCR activation. CD20/MS4A1 Protein, Human (Trx-His) is the recombinant human-derived CD20/MS4A1 protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.

Product Specifications

Product Name Alternative

CD20/MS4A1 Protein, Human (Trx-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd20-ms4a1-protein-human-trx-his.html

Purity

98.00

Smiles

IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQS

Molecular Formula

931 (Gene_ID) P11836-1 (I141-S188) (Accession)

Molecular Weight

Approximately 20.91 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse cluster of differentiation 44,CD44 ELISA KIT
JOT-EK1942Mo 96 wells

Mouse cluster of differentiation 44,CD44 ELISA KIT

Sign In for Pricing
View Details
CNOT1 sgRNA CRISPR Lentivector set (Human)
K0476501 3x 1.0 µg

CNOT1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit Anti-CD130 antibody
SL34036R-01 50 µL

Rabbit Anti-CD130 antibody

Sign In for Pricing
View Details
Rabbit Anti-CD130 antibody
SL34036R-02 100 µL

Rabbit Anti-CD130 antibody

Sign In for Pricing
View Details
LOC316932 3'UTR GFP Stable Cell Line
TU259963 1.0 mL

LOC316932 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
UBE2R2 Blocking Peptide
MBS9622516-01 1 mg

UBE2R2 Blocking Peptide

Sign In for Pricing
View Details