Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD20/MS4A1, Human (Trx-His)

CD20/MS4A1 protein is a B lymphocyte membrane protein that plays a crucial regulatory role in cellular calcium influx, which is essential for the development, differentiation and activation of B lymphocytes. As part of a store-operated calcium (SOC) channel, it promotes calcium influx upon B cell receptor/BCR activation. CD20/MS4A1 Protein, Human (Trx-His) is the recombinant human-derived CD20/MS4A1 protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.

Product Specifications

Product Name Alternative

CD20/MS4A1 Protein, Human (Trx-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd20-ms4a1-protein-human-trx-his.html

Purity

98.00

Smiles

IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQS

Molecular Formula

931 (Gene_ID) P11836-1 (I141-S188) (Accession)

Molecular Weight

Approximately 20.91 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pseudomonas Aeruginosa purA Protein (aa 1-430)
VAng-Cr0877-500gEcoli 500 µg (E. coli)

Recombinant Pseudomonas Aeruginosa purA Protein (aa 1-430)

Sign In for Pricing
View Details
DP-1 shRNA Plasmid (m)
sc-37814-SH 20 µg

DP-1 shRNA Plasmid (m)

Sign In for Pricing
View Details
Mouse Plscr2 activation kit by CRISPRa
GA203296 1 Kit

Mouse Plscr2 activation kit by CRISPRa

Sign In for Pricing
View Details
HNRNPM, Human (His-SUMO)
HY-P72234 1 Each

HNRNPM, Human (His-SUMO)

Sign In for Pricing
View Details
Metergoline (Standard)
HY-B1033R-01 5 mg

Metergoline (Standard)

Sign In for Pricing
View Details
Metergoline (Standard)
HY-B1033R-02 10 mg

Metergoline (Standard)

Sign In for Pricing
View Details