CD20/MS4A1, Human (Trx-His)
CD20/MS4A1 protein is a B lymphocyte membrane protein that plays a crucial regulatory role in cellular calcium influx, which is essential for the development, differentiation and activation of B lymphocytes. As part of a store-operated calcium (SOC) channel, it promotes calcium influx upon B cell receptor/BCR activation. CD20/MS4A1 Protein, Human (Trx-His) is the recombinant human-derived CD20/MS4A1 protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.
Product Specifications
Product Name Alternative
CD20/MS4A1 Protein, Human (Trx-His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd20-ms4a1-protein-human-trx-his.html
Purity
98.00
Smiles
IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQS
Molecular Formula
931 (Gene_ID) P11836-1 (I141-S188) (Accession)
Molecular Weight
Approximately 20.91 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
EIF3H, NT (EIF3H, EIF3S3, Eukaryotic translation initiation factor 3 subunit H, Eukaryotic translation initiation factor 3 subunit 3, eIF-3-gamma, eIF3 p40 subunit)
EIF3H, NT (EIF3H, EIF3S3, Eukaryotic translation initiation factor 3 subunit H, Eukaryotic translation initiation factor 3 subunit 3, eIF-3-gamma, eIF3 p40 subunit)
