Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD20/MS4A1, Human (Trx-His)

CD20/MS4A1 protein is a B lymphocyte membrane protein that plays a crucial regulatory role in cellular calcium influx, which is essential for the development, differentiation and activation of B lymphocytes. As part of a store-operated calcium (SOC) channel, it promotes calcium influx upon B cell receptor/BCR activation. CD20/MS4A1 Protein, Human (Trx-His) is the recombinant human-derived CD20/MS4A1 protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.

Product Specifications

Product Name Alternative

CD20/MS4A1 Protein, Human (Trx-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd20-ms4a1-protein-human-trx-his.html

Purity

98.00

Smiles

IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQS

Molecular Formula

931 (Gene_ID) P11836-1 (I141-S188) (Accession)

Molecular Weight

Approximately 20.91 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP20 Human shRNA Plasmid Kit (Locus ID 10868)
TL308462 1 Kit

USP20 Human shRNA Plasmid Kit (Locus ID 10868)

Sign In for Pricing
View Details
Pigyl (NM_001082532) Mouse Tagged ORF Clone Lentiviral Particle
MR217923L3V 200 µL

Pigyl (NM_001082532) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Monoclonal HVEM/TNFRSF14 Antibody (94801) [Allophycocyanin/Cy7]
FAB356APCCY7 0.1 mL

Mouse Monoclonal HVEM/TNFRSF14 Antibody (94801) [Allophycocyanin/Cy7]

Sign In for Pricing
View Details
SLC8A2 (NM_015063) Human Tagged ORF Clone
RC216354 10 µg

SLC8A2 (NM_015063) Human Tagged ORF Clone

Sign In for Pricing
View Details
NAG Recombinant Protein Antigen
NBP1-92164PEP 0.1 mL

NAG Recombinant Protein Antigen

Sign In for Pricing
View Details
Lentiviral mouse Vwa7 shRNA (UAS) - Lentiviral mouse Vwa7 shRNA (UAS, RFP) (100)
GTR15243816 1 Vial

Lentiviral mouse Vwa7 shRNA (UAS) - Lentiviral mouse Vwa7 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details