Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD20/MS4A1, Human (Trx-His)

CD20/MS4A1 protein is a B lymphocyte membrane protein that plays a crucial regulatory role in cellular calcium influx, which is essential for the development, differentiation and activation of B lymphocytes. As part of a store-operated calcium (SOC) channel, it promotes calcium influx upon B cell receptor/BCR activation. CD20/MS4A1 Protein, Human (Trx-His) is the recombinant human-derived CD20/MS4A1 protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.

Product Specifications

Product Name Alternative

CD20/MS4A1 Protein, Human (Trx-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd20-ms4a1-protein-human-trx-his.html

Purity

98.00

Smiles

IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQS

Molecular Formula

931 (Gene_ID) P11836-1 (I141-S188) (Accession)

Molecular Weight

Approximately 20.91 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ILite ADCC Target mTNF-alpha Negative Assay Ready Cells
BM5014 1 Each

ILite ADCC Target mTNF-alpha Negative Assay Ready Cells

Sign In for Pricing
View Details
RAPD Kit (Random Amplified Polymorphic DNA), BioGenomicsTM, Kit-04
R1125-04 1 Kit

RAPD Kit (Random Amplified Polymorphic DNA), BioGenomicsTM, Kit-04

Sign In for Pricing
View Details
TBC1D10A sgRNA CRISPR Lentivector (Human) (Target 1)
K2339902 1.0 µg DNA

TBC1D10A sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Single Donor Human Female Rectal Swab 1
MBS8421307-01 1 Each

Single Donor Human Female Rectal Swab 1

Sign In for Pricing
View Details
Single Donor Human Female Rectal Swab 1
MBS8421307-02 5x 1 Each

Single Donor Human Female Rectal Swab 1

Sign In for Pricing
View Details
Rabbit Anti-Human POLR2B pAb
PA14477-01 50 μL

Rabbit Anti-Human POLR2B pAb

Sign In for Pricing
View Details