Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Product Specifications

Target

Glucagon Receptor

Related Pathways

GPCR/G Protein

Bioactivity

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

Molecular Formula

3692.15

Molecular Weight

3692.15

Shipping Conditions

Ice Packs

Storage Temperature

-20°C

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL
BNC880146-500 1x 500 µL

CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL
BNC050391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (KP1), CF405M conjugate, 0.1mg/mL
BNC050512-100 1x 100 µL

CD68 (KP1), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 5/6/18 (LP34), CF405S conjugate, 0.1mg/mL
BNC042036-100 1x 100 µL

Cytokeratin 5/6/18 (LP34), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cdc20 (CDC20/1102), CF405S conjugate, 0.1mg/mL
BNC041102-500 1x 500 µL

Cdc20 (CDC20/1102), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details