Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Product Specifications

Target

Glucagon Receptor

Related Pathways

GPCR/G Protein

Bioactivity

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

Molecular Formula

3692.15

Molecular Weight

3692.15

Shipping Conditions

Cool pack

Storage Temperature

-20°C

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc5a12 (NM_001177624) Mouse Tagged Lenti ORF Clone
MR224573L3 10 µg

Slc5a12 (NM_001177624) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
GAP43 Monoclonal Antibody, APC Conjugated
bsm-33192M-APC-01 20 µL

GAP43 Monoclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
GAP43 Monoclonal Antibody, APC Conjugated
bsm-33192M-APC-02 100 µL

GAP43 Monoclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
DDIT3 Rabbit Polyclonal Antibody
TA312978 100 µL

DDIT3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MES Buffer 0.2M, pH 6.0
41320075-2 250 mL

MES Buffer 0.2M, pH 6.0

Sign In for Pricing
View Details
CS Protein (C-His, Human)
P523588 100 µg

CS Protein (C-His, Human)

Sign In for Pricing
View Details