Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Product Specifications

Target

Glucagon Receptor

Related Pathways

GPCR/G Protein

Bioactivity

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

Molecular Formula

3692.15

Molecular Weight

3692.15

Shipping Conditions

Cool pack

Storage Temperature

-20°C

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal Frizzled-4 Antibody (145901) [Janelia Fluor 646]
FAB194J 0.1 mL

Rat Monoclonal Frizzled-4 Antibody (145901) [Janelia Fluor 646]

Sign In for Pricing
View Details
CYPIVF11 (CYP4F11) (NM_001128932) Human Tagged ORF Clone
RG225897 10 µg

CYPIVF11 (CYP4F11) (NM_001128932) Human Tagged ORF Clone

Sign In for Pricing
View Details
Vps4a siRNA Oligos set (Rat)
50191176 3x 5 nmol

Vps4a siRNA Oligos set (Rat)

Sign In for Pricing
View Details
ELMOD3 Antibody, FITC conjugated
MBS7108469-01 0.05 mg

ELMOD3 Antibody, FITC conjugated

Sign In for Pricing
View Details
ELMOD3 Antibody, FITC conjugated
MBS7108469-02 0.1 mg

ELMOD3 Antibody, FITC conjugated

Sign In for Pricing
View Details
ELMOD3 Antibody, FITC conjugated
MBS7108469-03 5x 0.1 mg

ELMOD3 Antibody, FITC conjugated

Sign In for Pricing
View Details