Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Product Specifications

Target

Glucagon Receptor

Related Pathways

GPCR/G Protein

Bioactivity

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

Molecular Formula

3692.15

Molecular Weight

3692.15

Shipping Conditions

Cool pack

Storage Temperature

-20°C

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Clostridium Tetani glmM Protein (aa 1-448)

VAng-Lsx01625-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Tetani glmM Protein (aa 1-448)

Sign In for Pricing

Rabbit Polyclonal EBI3 Antibody [DyLight 755]

NBP2-03944IR 0.1 mL

Rabbit Polyclonal EBI3 Antibody [DyLight 755]

Sign In for Pricing

INPP4B (NM_001101669) Human Over-expression Lysate

LY420324 100 µg

INPP4B (NM_001101669) Human Over-expression Lysate

Sign In for Pricing

Anti-NUT Rabbit pAb

GB112941 100 μL

Anti-NUT Rabbit pAb

Sign In for Pricing

Goat 1,25-(OH)2D ELISA Kit

EGTD0276 96 Tests

Goat 1,25-(OH)2D ELISA Kit

Sign In for Pricing

Human APOC4/Apolipoprotein C-IV ELISA Kit

E0182Hu 96 Tests

Human APOC4/Apolipoprotein C-IV ELISA Kit

Sign In for Pricing