Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Natriuretic peptides A/NPPA, Human (P. pastoris, His)

Natriuretic peptide A/NPPA is critical for cardiorenal homeostasis and regulates vascular remodeling and energy metabolism by binding to NPR1. This stimulates the production of c, activating PRKG1 to respond differently. Natriuretic peptides A/NPPA Protein, Human (P. pastoris, His) is the recombinant human-derived Natriuretic peptides A/NPPA protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Natriuretic peptides A/NPPA Protein, Human (P. pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/natriuretic-peptides-a-nppa-protein-human-p-pastoris-his.html

Purity

94.00

Smiles

PEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKL

Molecular Formula

4878 (Gene_ID) P01160 (P78-L115) (Accession)

Molecular Weight

5.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methyl β-D-glucopyranoside
M33611-01 100 mg

Methyl β-D-glucopyranoside

Sign In for Pricing
View Details
Methyl β-D-glucopyranoside
M33611-02 200 mg

Methyl β-D-glucopyranoside

Sign In for Pricing
View Details
Methyl β-D-glucopyranoside
M33611-03 500 mg

Methyl β-D-glucopyranoside

Sign In for Pricing
View Details
Methyl β-D-glucopyranoside
M33611-04 1 g

Methyl β-D-glucopyranoside

Sign In for Pricing
View Details
Native Trypsin (TRY)
SHPA217Po01-01 10 µg

Native Trypsin (TRY)

Sign In for Pricing
View Details
Native Trypsin (TRY)
SHPA217Po01-02 50 µg

Native Trypsin (TRY)

Sign In for Pricing
View Details