Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Natriuretic peptides A/NPPA, Human (P. pastoris, His)

Natriuretic peptide A/NPPA is critical for cardiorenal homeostasis and regulates vascular remodeling and energy metabolism by binding to NPR1. This stimulates the production of c, activating PRKG1 to respond differently. Natriuretic peptides A/NPPA Protein, Human (P. pastoris, His) is the recombinant human-derived Natriuretic peptides A/NPPA protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Natriuretic peptides A/NPPA Protein, Human (P. pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/natriuretic-peptides-a-nppa-protein-human-p-pastoris-his.html

Purity

94.00

Smiles

PEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKL

Molecular Formula

4878 (Gene_ID) P01160 (P78-L115) (Accession)

Molecular Weight

5.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rtcd1 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4031803 1.0 µg DNA

Rtcd1 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Human Breast Carcinoma Amplified Sequence 1 (BCAS1) ELISA Kit
abx386019 96 Tests

Human Breast Carcinoma Amplified Sequence 1 (BCAS1) ELISA Kit

Sign In for Pricing
View Details
Rat Tssk1b Pre-designed siRNA Set B
SI215326B 1 Each

Rat Tssk1b Pre-designed siRNA Set B

Sign In for Pricing
View Details
Cyp51 Protein Vector (Mouse) (pPB-N-His)
PV169823 500 ng

Cyp51 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Lysipressin Acetate
MBS826397-01 1 mg

Lysipressin Acetate

Sign In for Pricing
View Details
Lysipressin Acetate
MBS826397-02 5 mg

Lysipressin Acetate

Sign In for Pricing
View Details