Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-6, Human (His)

IL-6 protein is a multifunctional cytokine that plays multiple biological functions in immunity, tissue regeneration, and metabolism. After binding to IL6R, the resulting complex binds to the signaling subunit IL6ST/gp130, triggering the intracellular IL6 signaling pathway. Animal-Free IL-6 Protein, Human (His) is the recombinant human-derived animal-FreeIL-6 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-6 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-6-protein-human-his.html

Purity

98.0

Smiles

MVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Molecular Formula

3569 (Gene_ID) P05231 (P29-M212) (Accession)

Molecular Weight

Approximately 22 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KDM5A knockdown cell line
ABC-KD7782 1 Vial

Human KDM5A knockdown cell line

Sign In for Pricing
View Details
Guanine Nucleotide Binding Protein Gamma 4 Human Recombinant
rAP-3356 1 Each

Guanine Nucleotide Binding Protein Gamma 4 Human Recombinant

Sign In for Pricing
View Details
Recombinant Bacillus clausii Gamma-glutamyl phosphate reductase (proA)
MBS1449431-01 0.02 mg (E-Coli)

Recombinant Bacillus clausii Gamma-glutamyl phosphate reductase (proA)

Sign In for Pricing
View Details
Recombinant Bacillus clausii Gamma-glutamyl phosphate reductase (proA)
MBS1449431-02 0.02 mg (Yeast)

Recombinant Bacillus clausii Gamma-glutamyl phosphate reductase (proA)

Sign In for Pricing
View Details
Recombinant Bacillus clausii Gamma-glutamyl phosphate reductase (proA)
MBS1449431-03 0.1 mg (E-Coli)

Recombinant Bacillus clausii Gamma-glutamyl phosphate reductase (proA)

Sign In for Pricing
View Details
Recombinant Bacillus clausii Gamma-glutamyl phosphate reductase (proA)
MBS1449431-04 0.1 mg (Yeast)

Recombinant Bacillus clausii Gamma-glutamyl phosphate reductase (proA)

Sign In for Pricing
View Details