Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhesus Macaque Pro-interleukin-16 [Cleaved into: Interleukin-16 protein (IL16) (Active)

Product Specifications

Product Name Alternative

IL-16, LCF, ]

Abbreviation

Recombinant Rhesus macaque IL16 protein (Active)

Gene Name

IL16

UniProt

O62675

Expression Region

510-630aa

Organism

Macaca mulatta (Rhesus macaque)

Target Sequence

SAASASAASDVSVESSAEATVYTVTLEKMSAGLGFSLEGGKGSLHGDKPLTINRIFKGAASEQSETIQPGDEILQLAGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQPKETTAAADS

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Immunology

Relevance

Interleukin-16 stimulates a migratory response in CD4+ lymphocytes, monocytes, and eosinophils. Primes CD4+ T-cells for IL-2 and IL-15 responsiveness. Also induces T-lymphocyte expression of interleukin 2 receptor. Ligand for CD4 (By similarity) . {ECO:0000250}.; Pro-interleukin-16 is involved in cell cycle progression in T-cells. Appears to be involved in transcriptional regulation of SKP2 and is probably part of a transcriptional repression complex on the core promoter of the SKP2 gene. May act as a scaffold for GABPB1 (the DNA-binding subunit the GABP transcription factor complex) and HDAC3 thus maintaining transcriptional repression and blocking cell cycle progression in resting T-cells (By similarity) . {ECO:0000250}.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>98% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral T lymphocytes is in a concentration range of 1.0-100 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 µm filtered PBS, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Interleukin-16 stimulates a migratory response in CD4+ lymphocytes, monocytes, and eosinophils. Primes CD4+ T-cells for IL-2 and IL-15 responsiveness. Also induces T-lymphocyte expression of interleukin 2 receptor. Ligand for CD4 (By similarity) .

Molecular Weight

12.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Ephrin A4 (EFNA4) (NM_005227) Human Tagged Lenti ORF Clone
RC224388L3 10 µg

Ephrin A4 (EFNA4) (NM_005227) Human Tagged Lenti ORF Clone

Ask
View Details
Runx1 (Runt-Related Transcription Factor 1, Acute Myeloid Leukemia 1 Protein, Core-Binding Factor Subunit alpha-2, CBF-alpha-2, Oncogene AML-1, Polyomavirus Enhancer-Binding Protein 2 alpha B Subunit, PEA2-alpha B, PEBP2-alpha B, SL3-3 Enhancer Factor 1 alpha B Subunit, SL3/AKV core-Binding Factor alpha B Subunit, Runx1, Aml1, Cbfa2, Pebp2ab) (MaxLight 650) discontinued
302721-ML650 100 µL

Runx1 (Runt-Related Transcription Factor 1, Acute Myeloid Leukemia 1 Protein, Core-Binding Factor Subunit alpha-2, CBF-alpha-2, Oncogene AML-1, Polyomavirus Enhancer-Binding Protein 2 alpha B Subunit, PEA2-alpha B, PEBP2-alpha B, SL3-3 Enhancer Factor 1 alpha B Subunit, SL3/AKV core-Binding Factor alpha B Subunit, Runx1, Aml1, Cbfa2, Pebp2ab) (MaxLight 650) discontinued

Ask
View Details
PDPN (1-206) Mouse Monoclonal Antibody [Clone ID: 5E2]
AM03203PU-N 100 µL

PDPN (1-206) Mouse Monoclonal Antibody [Clone ID: 5E2]

Ask
View Details