Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-5, Mouse (HEK293, His)

IL-5 protein is expressed by T lymphocytes and NK cells and regulates eosinophils, affecting their survival, differentiation and chemotaxis.In addition, IL-5 stimulates immunoglobulin production, growth, and differentiation of activated and resting B cells.IL-5 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-5 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-5-protein-mouse-hek293-his.html

Purity

95.0

Smiles

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Molecular Formula

16191 (Gene_ID) P04401 (M21-G133) (Accession)

Molecular Weight

Approximately 14-26 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTPRN 3'UTR Luciferase Stable Cell Line
TU019230 1.0 mL

PTPRN 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Pongo abelii Ankyrin repeat and SOCS box protein 11 (ASB11)
MBS1350977-01 0.02 mg (E-Coli)

Recombinant Pongo abelii Ankyrin repeat and SOCS box protein 11 (ASB11)

Sign In for Pricing
View Details
Recombinant Pongo abelii Ankyrin repeat and SOCS box protein 11 (ASB11)
MBS1350977-02 0.02 mg (Yeast)

Recombinant Pongo abelii Ankyrin repeat and SOCS box protein 11 (ASB11)

Sign In for Pricing
View Details
Recombinant Pongo abelii Ankyrin repeat and SOCS box protein 11 (ASB11)
MBS1350977-03 0.1 mg (E-Coli)

Recombinant Pongo abelii Ankyrin repeat and SOCS box protein 11 (ASB11)

Sign In for Pricing
View Details
Recombinant Pongo abelii Ankyrin repeat and SOCS box protein 11 (ASB11)
MBS1350977-04 0.1 mg (Yeast)

Recombinant Pongo abelii Ankyrin repeat and SOCS box protein 11 (ASB11)

Sign In for Pricing
View Details
Recombinant Pongo abelii Ankyrin repeat and SOCS box protein 11 (ASB11)
MBS1350977-05 0.02 mg (Baculovirus)

Recombinant Pongo abelii Ankyrin repeat and SOCS box protein 11 (ASB11)

Sign In for Pricing
View Details