Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-5, Mouse (HEK293, His)

IL-5 protein is expressed by T lymphocytes and NK cells and regulates eosinophils, affecting their survival, differentiation and chemotaxis.In addition, IL-5 stimulates immunoglobulin production, growth, and differentiation of activated and resting B cells.IL-5 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-5 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-5-protein-mouse-hek293-his.html

Purity

95.0

Smiles

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Molecular Formula

16191 (Gene_ID) P04401 (M21-G133) (Accession)

Molecular Weight

Approximately 14-26 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNK7 (NM_033347) Human Over-expression Lysate
LY409584 100 µg

KCNK7 (NM_033347) Human Over-expression Lysate

Sign In for Pricing
View Details
ATG16L, phosphorylated (S287) (ATG16L1, APG16L, Autophagy-related protein 16-1, APG16-like 1) discontinued
032181 200 µL

ATG16L, phosphorylated (S287) (ATG16L1, APG16L, Autophagy-related protein 16-1, APG16-like 1) discontinued

Sign In for Pricing
View Details
Mousecommon acute lymphocytic leukaemia antigen (CALLA) ELISA Kit
EIA05420m 1 Kit

Mousecommon acute lymphocytic leukaemia antigen (CALLA) ELISA Kit

Sign In for Pricing
View Details
CaMK4 Cell ELISA Kit
abx595084 96 Tests

CaMK4 Cell ELISA Kit

Sign In for Pricing
View Details
OR1N2 (NM_001004457) Human Tagged Lenti ORF Clone
RC222019L4 10 µg

OR1N2 (NM_001004457) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit anti-MSH4 Antibody
MBS4508374-01 0.05 mL

Rabbit anti-MSH4 Antibody

Sign In for Pricing
View Details