Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-5, Mouse (HEK293, His)

IL-5 protein is expressed by T lymphocytes and NK cells and regulates eosinophils, affecting their survival, differentiation and chemotaxis.In addition, IL-5 stimulates immunoglobulin production, growth, and differentiation of activated and resting B cells.IL-5 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-5 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-5-protein-mouse-hek293-his.html

Purity

95.0

Smiles

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Molecular Formula

16191 (Gene_ID) P04401 (M21-G133) (Accession)

Molecular Weight

Approximately 14-26 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFAF4 Recombinant Rabbit mAb
E43S46588 100 µL

NDUFAF4 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Lentiviral mouse Eepd1 shRNA (UAS) - Lentiviral mouse Eepd1 shRNA (UAS) plasmid
GTR15149359 1 Vial

Lentiviral mouse Eepd1 shRNA (UAS) - Lentiviral mouse Eepd1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Human Antiphosphatidic acid IgM antibody (PAAb IgM) ELISA Kit
YP-W18452-01 48 Tests

Human Antiphosphatidic acid IgM antibody (PAAb IgM) ELISA Kit

Sign In for Pricing
View Details
Human Antiphosphatidic acid IgM antibody (PAAb IgM) ELISA Kit
YP-W18452-02 96 Tests

Human Antiphosphatidic acid IgM antibody (PAAb IgM) ELISA Kit

Sign In for Pricing
View Details
Hus1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3367302 1.0 µg DNA

Hus1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Fam96b sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3082104 1.0 µg DNA

Fam96b sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details