Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-5, Mouse (HEK293, His)

IL-5 protein is expressed by T lymphocytes and NK cells and regulates eosinophils, affecting their survival, differentiation and chemotaxis.In addition, IL-5 stimulates immunoglobulin production, growth, and differentiation of activated and resting B cells.IL-5 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-5 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-5-protein-mouse-hek293-his.html

Purity

95.0

Smiles

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Molecular Formula

16191 (Gene_ID) P04401 (M21-G133) (Accession)

Molecular Weight

Approximately 14-26 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Mysm1 (NM_177239) AAV Particle
MR216767A1V 250 µL

Mouse Mysm1 (NM_177239) AAV Particle

Sign In for Pricing
View Details
GOT1L1 (NM_152413) Human Recombinant Protein
TP306121 20 µg

GOT1L1 (NM_152413) Human Recombinant Protein

Sign In for Pricing
View Details
(S)-2,4-Dihydroxybutanoic Acid Lithium Salt
TRC-D329350-100MG 100 mg

(S)-2,4-Dihydroxybutanoic Acid Lithium Salt

Sign In for Pricing
View Details
TRPM3 (NM_001007471) Human 3' UTR Clone
SC211105 10 µg

TRPM3 (NM_001007471) Human 3' UTR Clone

Sign In for Pricing
View Details
Rat Ddb1 Pre-designed siRNA Set A
SI203624A 1 Each

Rat Ddb1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
1300018I17Rik (BC057621) Mouse Tagged Lenti ORF Clone
MR208798L3 10 µg

1300018I17Rik (BC057621) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details