Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-5, Mouse (HEK293, His)

IL-5 protein is expressed by T lymphocytes and NK cells and regulates eosinophils, affecting their survival, differentiation and chemotaxis.In addition, IL-5 stimulates immunoglobulin production, growth, and differentiation of activated and resting B cells.IL-5 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-5 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-5-protein-mouse-hek293-his.html

Purity

95.0

Smiles

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Molecular Formula

16191 (Gene_ID) P04401 (M21-G133) (Accession)

Molecular Weight

Approximately 14-26 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTSA (NM_001127695) Human Tagged ORF Clone
RC225815 10 µg

CTSA (NM_001127695) Human Tagged ORF Clone

Sign In for Pricing
View Details
Monoclonal Antibody to Neurofilament (NF-H) (Neuronal Marker) (Clone : RT97)
36-1509-100 100 µg

Monoclonal Antibody to Neurofilament (NF-H) (Neuronal Marker) (Clone : RT97)

Sign In for Pricing
View Details
ZBTB47 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2663806 1.0 µg DNA

ZBTB47 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Ms4a1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6696405 3x 1.0 µg

Ms4a1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
PE-Cy7 anti-mouse CD26 (DPP-4)
E16FMN026-100U 100 µg

PE-Cy7 anti-mouse CD26 (DPP-4)

Sign In for Pricing
View Details
Phospho-Acetyl Coenzyme A Carboxylase (S79) Recombinant Rabbit Monoclonal Antibody [JE63-95]
HA721714 100 µL

Phospho-Acetyl Coenzyme A Carboxylase (S79) Recombinant Rabbit Monoclonal Antibody [JE63-95]

Sign In for Pricing
View Details