Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-5, Mouse (HEK293, His)

IL-5 protein is expressed by T lymphocytes and NK cells and regulates eosinophils, affecting their survival, differentiation and chemotaxis.In addition, IL-5 stimulates immunoglobulin production, growth, and differentiation of activated and resting B cells.IL-5 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-5 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-5-protein-mouse-hek293-his.html

Purity

95.0

Smiles

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Molecular Formula

16191 (Gene_ID) P04401 (M21-G133) (Accession)

Molecular Weight

Approximately 14-26 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Armenian Hamster Monoclonal NUP62 Antibody (RL31) [DyLight 650]
NB120-2736C 0.1 mL

Armenian Hamster Monoclonal NUP62 Antibody (RL31) [DyLight 650]

Sign In for Pricing
View Details
P2Y6 (P2RY6) (NM_176797) Human Tagged ORF Clone
RG200617 10 µg

P2Y6 (P2RY6) (NM_176797) Human Tagged ORF Clone

Sign In for Pricing
View Details
TMED1 Protein Vector (Rat) (pPM-C-His)
PV311181 500 ng

TMED1 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Lentiviral mouse Vmn1r217 shRNA (UAS) - Lentiviral mouse Vmn1r217 shRNA (UAS, iRFP) (25)
GTR15151646 1 Vial

Lentiviral mouse Vmn1r217 shRNA (UAS) - Lentiviral mouse Vmn1r217 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Rabbit Polyclonal DYRK1A Antibody [Alexa Fluor 594]
NBP1-76559AF594 0.1 mL

Rabbit Polyclonal DYRK1A Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
Human ST2/IL-1 RL1 Antibody Pair Set
ABPR-ZB077 5 plates, 15 plates

Human ST2/IL-1 RL1 Antibody Pair Set

Sign In for Pricing
View Details