Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-5, Mouse (HEK293, His)

IL-5 protein is expressed by T lymphocytes and NK cells and regulates eosinophils, affecting their survival, differentiation and chemotaxis.In addition, IL-5 stimulates immunoglobulin production, growth, and differentiation of activated and resting B cells.IL-5 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-5 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-5-protein-mouse-hek293-his.html

Purity

95.0

Smiles

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Molecular Formula

16191 (Gene_ID) P04401 (M21-G133) (Accession)

Molecular Weight

Approximately 14-26 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SLC6A8 ELISA Kit (Colorimetric)
NBP3-27448 1 Kit

Human SLC6A8 ELISA Kit (Colorimetric)

Sign In for Pricing
View Details
Crucibles, Porcelain, Squat Form
2062730/7 1 Each

Crucibles, Porcelain, Squat Form

Sign In for Pricing
View Details
DSP Crosslinker
571620 100.0mg

DSP Crosslinker

Sign In for Pricing
View Details
Catalase-1 (CAT1) Antibody
abx340881-01 20 µL

Catalase-1 (CAT1) Antibody

Sign In for Pricing
View Details
Catalase-1 (CAT1) Antibody
abx340881-02 50 µL

Catalase-1 (CAT1) Antibody

Sign In for Pricing
View Details
Catalase-1 (CAT1) Antibody
abx340881-03 100 µL

Catalase-1 (CAT1) Antibody

Sign In for Pricing
View Details