Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-5, Mouse (HEK293, His)

IL-5 protein is expressed by T lymphocytes and NK cells and regulates eosinophils, affecting their survival, differentiation and chemotaxis.In addition, IL-5 stimulates immunoglobulin production, growth, and differentiation of activated and resting B cells.IL-5 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-5 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-5-protein-mouse-hek293-his.html

Purity

95.0

Smiles

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Molecular Formula

16191 (Gene_ID) P04401 (M21-G133) (Accession)

Molecular Weight

Approximately 14-26 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

F13B Antibody, HRP conjugated
MBS7108857-01 0.05 mg

F13B Antibody, HRP conjugated

Sign In for Pricing
View Details
F13B Antibody, HRP conjugated
MBS7108857-02 0.1 mg

F13B Antibody, HRP conjugated

Sign In for Pricing
View Details
F13B Antibody, HRP conjugated
MBS7108857-03 5x 0.1 mg

F13B Antibody, HRP conjugated

Sign In for Pricing
View Details
Human Rho GTPase-activating protein 10, ARHGAP10 ELISA KIT
ELI-35573h 96 Tests

Human Rho GTPase-activating protein 10, ARHGAP10 ELISA KIT

Sign In for Pricing
View Details
ASF1A, CT (ASF1A, Histone chaperone ASF1A, Anti-silencing function protein 1 homolog A, CCG1-interacting factor A) (MaxLight 750) discontinued
032133-ML750 100 µL

ASF1A, CT (ASF1A, Histone chaperone ASF1A, Anti-silencing function protein 1 homolog A, CCG1-interacting factor A) (MaxLight 750) discontinued

Sign In for Pricing
View Details
LARP4 (La-related protein 4, PP13296) (Biotin)
MBS6424408-01 0.1 mL

LARP4 (La-related protein 4, PP13296) (Biotin)

Sign In for Pricing
View Details