Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-5, Mouse (HEK293, His)

IL-5 protein is expressed by T lymphocytes and NK cells and regulates eosinophils, affecting their survival, differentiation and chemotaxis.In addition, IL-5 stimulates immunoglobulin production, growth, and differentiation of activated and resting B cells.IL-5 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-5 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-5-protein-mouse-hek293-his.html

Purity

95.0

Smiles

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Molecular Formula

16191 (Gene_ID) P04401 (M21-G133) (Accession)

Molecular Weight

Approximately 14-26 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMB3 (Proteasome Subunit beta Type-3, Proteasome Chain 13, Proteasome Component C10-II, Proteasome theta Chain, PSMB3) (MaxLight 650)
MBS6458524-01 0.1 mL

PSMB3 (Proteasome Subunit beta Type-3, Proteasome Chain 13, Proteasome Component C10-II, Proteasome theta Chain, PSMB3) (MaxLight 650)

Sign In for Pricing
View Details
PSMB3 (Proteasome Subunit beta Type-3, Proteasome Chain 13, Proteasome Component C10-II, Proteasome theta Chain, PSMB3) (MaxLight 650)
MBS6458524-02 5x 0.1 mL

PSMB3 (Proteasome Subunit beta Type-3, Proteasome Chain 13, Proteasome Component C10-II, Proteasome theta Chain, PSMB3) (MaxLight 650)

Sign In for Pricing
View Details
Ncor1 3'UTR Luciferase Stable Cell Line
TU213796 1.0 mL

Ncor1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Anti-B4GALT5 Rabbit pAb
GB112912-50 50 μL

Anti-B4GALT5 Rabbit pAb

Sign In for Pricing
View Details
Rabbit Monoclonal p27/Kip1 Antibody (KIP1/9168R) [DyLight 755]
NBP3-24282IR 0.1 mL

Rabbit Monoclonal p27/Kip1 Antibody (KIP1/9168R) [DyLight 755]

Sign In for Pricing
View Details
RABEK rabbit pAb
MBS8601679-01 0.1 mL

RABEK rabbit pAb

Sign In for Pricing
View Details