Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-5, Mouse (HEK293, His)

IL-5 protein is expressed by T lymphocytes and NK cells and regulates eosinophils, affecting their survival, differentiation and chemotaxis.In addition, IL-5 stimulates immunoglobulin production, growth, and differentiation of activated and resting B cells.IL-5 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-5 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-5-protein-mouse-hek293-his.html

Purity

95.0

Smiles

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Molecular Formula

16191 (Gene_ID) P04401 (M21-G133) (Accession)

Molecular Weight

Approximately 14-26 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1560691 CRISPRa sgRNA lentivector (set of three targets)(Rat)
39225126 3x 1.0µg DNA

RGD1560691 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Legionella pneumophila One-Step PCR kit
Oneq-H436-150D 150 Reactions

Legionella pneumophila One-Step PCR kit

Sign In for Pricing
View Details
Rat Extracellular superoxide dismutase [Cu-Zn],Sod3 ELISA KIT
ELI-07058r 96 Tests

Rat Extracellular superoxide dismutase [Cu-Zn],Sod3 ELISA KIT

Sign In for Pricing
View Details
Rabbit Polyclonal SHARPIN Antibody [Alexa Fluor 750]
NBP2-04116AF750 0.1 mL

Rabbit Polyclonal SHARPIN Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
SSX11, NT (SSX11, Protein SSX11) (MaxLight 405)
MBS6351416-01 0.1 mL

SSX11, NT (SSX11, Protein SSX11) (MaxLight 405)

Sign In for Pricing
View Details
SSX11, NT (SSX11, Protein SSX11) (MaxLight 405)
MBS6351416-02 5x 0.1 mL

SSX11, NT (SSX11, Protein SSX11) (MaxLight 405)

Sign In for Pricing
View Details