Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-5, Mouse (HEK293, His)

IL-5 protein is expressed by T lymphocytes and NK cells and regulates eosinophils, affecting their survival, differentiation and chemotaxis.In addition, IL-5 stimulates immunoglobulin production, growth, and differentiation of activated and resting B cells.IL-5 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-5 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-5-protein-mouse-hek293-his.html

Purity

95.0

Smiles

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Molecular Formula

16191 (Gene_ID) P04401 (M21-G133) (Accession)

Molecular Weight

Approximately 14-26 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL5P20 sgRNA CRISPR Lentivector (Human) (Target 1)
K1876902 1.0 µg DNA

RPL5P20 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
PRKRIR Protein Lysate (Human) with C-Ha Tag
37657032 100 µg

PRKRIR Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Human IL-28 R alpha/IFN-lambda R1 Alexa Fluor 594 Antibody
FAB5260T-100UG 100 µg

Human IL-28 R alpha/IFN-lambda R1 Alexa Fluor 594 Antibody

Sign In for Pricing
View Details
4EBP1 Antibody (HRP)
abx449609-01 10x 96 Tests

4EBP1 Antibody (HRP)

Sign In for Pricing
View Details
4EBP1 Antibody (HRP)
abx449609-02 5x 96 Tests

4EBP1 Antibody (HRP)

Sign In for Pricing
View Details
4EBP1 Antibody (HRP)
abx449609-03 100 µg

4EBP1 Antibody (HRP)

Sign In for Pricing
View Details