Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-5, Mouse (HEK293, His)

IL-5 protein is expressed by T lymphocytes and NK cells and regulates eosinophils, affecting their survival, differentiation and chemotaxis.In addition, IL-5 stimulates immunoglobulin production, growth, and differentiation of activated and resting B cells.IL-5 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-5 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-5-protein-mouse-hek293-his.html

Purity

95.0

Smiles

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Molecular Formula

16191 (Gene_ID) P04401 (M21-G133) (Accession)

Molecular Weight

Approximately 14-26 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Gap junction epsilon-1 protein (GJE1)
MBS7015762-01 0.02 mg

Recombinant Human Gap junction epsilon-1 protein (GJE1)

Sign In for Pricing
View Details
Recombinant Human Gap junction epsilon-1 protein (GJE1)
MBS7015762-02 0.1 mg

Recombinant Human Gap junction epsilon-1 protein (GJE1)

Sign In for Pricing
View Details
Recombinant Human Gap junction epsilon-1 protein (GJE1)
MBS7015762-03 5x 0.1 mg

Recombinant Human Gap junction epsilon-1 protein (GJE1)

Sign In for Pricing
View Details
AARD (NM_001025357) Human Tagged ORF Clone
RG214088 10 µg

AARD (NM_001025357) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal COX11 Antibody [DyLight 550]
NBP2-97240R 0.1 mL

Rabbit Polyclonal COX11 Antibody [DyLight 550]

Sign In for Pricing
View Details
Mouse Monoclonal GABA-A R alpha 2 Antibody (S399-19) [Alexa Fluor 647]
NBP2-59325AF647 100 µL

Mouse Monoclonal GABA-A R alpha 2 Antibody (S399-19) [Alexa Fluor 647]

Sign In for Pricing
View Details