Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-5, Mouse (HEK293, His)

IL-5 protein is expressed by T lymphocytes and NK cells and regulates eosinophils, affecting their survival, differentiation and chemotaxis.In addition, IL-5 stimulates immunoglobulin production, growth, and differentiation of activated and resting B cells.IL-5 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-5 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-5-protein-mouse-hek293-his.html

Purity

95.0

Smiles

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Molecular Formula

16191 (Gene_ID) P04401 (M21-G133) (Accession)

Molecular Weight

Approximately 14-26 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Fc gamma RIII/CD16 Alexa Fluor 594 MAb (1001049)
FAB4325T-100UG 100 µg

Human Fc gamma RIII/CD16 Alexa Fluor 594 MAb (1001049)

Sign In for Pricing
View Details
Goat anti-Syrian Hamster IgG Heavy and Light Chain Antibody Biotinylated
MBS3900511-01 1 mg

Goat anti-Syrian Hamster IgG Heavy and Light Chain Antibody Biotinylated

Sign In for Pricing
View Details
Goat anti-Syrian Hamster IgG Heavy and Light Chain Antibody Biotinylated
MBS3900511-02 5x 1 mg

Goat anti-Syrian Hamster IgG Heavy and Light Chain Antibody Biotinylated

Sign In for Pricing
View Details
Rat Rps28 ELISA Kit
ELI-36321r 96 Tests

Rat Rps28 ELISA Kit

Sign In for Pricing
View Details
Tnfsf4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7018708 1.0 µg DNA

Tnfsf4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
ECHS1, 28-290aa, Human, His-tag, E Coli (Bioactivity Validated)
MBS206573-01 0.004 mg

ECHS1, 28-290aa, Human, His-tag, E Coli (Bioactivity Validated)

Sign In for Pricing
View Details