Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-5, Mouse (HEK293, His)

IL-5 protein is expressed by T lymphocytes and NK cells and regulates eosinophils, affecting their survival, differentiation and chemotaxis.In addition, IL-5 stimulates immunoglobulin production, growth, and differentiation of activated and resting B cells.IL-5 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-5 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-5-protein-mouse-hek293-his.html

Purity

95.0

Smiles

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Molecular Formula

16191 (Gene_ID) P04401 (M21-G133) (Accession)

Molecular Weight

Approximately 14-26 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Camel Pumilio Homolog 1 (PUM1) ELISA Kit
MBS9395717-01 48 Well

Camel Pumilio Homolog 1 (PUM1) ELISA Kit

Sign In for Pricing
View Details
Camel Pumilio Homolog 1 (PUM1) ELISA Kit
MBS9395717-02 96 Well

Camel Pumilio Homolog 1 (PUM1) ELISA Kit

Sign In for Pricing
View Details
Camel Pumilio Homolog 1 (PUM1) ELISA Kit
MBS9395717-03 5x 96 Well

Camel Pumilio Homolog 1 (PUM1) ELISA Kit

Sign In for Pricing
View Details
Camel Pumilio Homolog 1 (PUM1) ELISA Kit
MBS9395717-04 10x 96 Well

Camel Pumilio Homolog 1 (PUM1) ELISA Kit

Sign In for Pricing
View Details
1-acylglycerol-3-phosphate O-acyltransferase ABHD5 (ABHD5) Human ELISA Kit
B0050 96 Tests

1-acylglycerol-3-phosphate O-acyltransferase ABHD5 (ABHD5) Human ELISA Kit

Sign In for Pricing
View Details
Human CDK7 (Cyclin Dependent Kinase 7) ValidElisa Kit
EK341247 96 Well

Human CDK7 (Cyclin Dependent Kinase 7) ValidElisa Kit

Sign In for Pricing
View Details