Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-5, Mouse (HEK293, His)

IL-5 protein is expressed by T lymphocytes and NK cells and regulates eosinophils, affecting their survival, differentiation and chemotaxis.In addition, IL-5 stimulates immunoglobulin production, growth, and differentiation of activated and resting B cells.IL-5 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-5 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-5-protein-mouse-hek293-his.html

Purity

95.0

Smiles

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Molecular Formula

16191 (Gene_ID) P04401 (M21-G133) (Accession)

Molecular Weight

Approximately 14-26 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MANF Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV687892 1.0 µg DNA

MANF Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Human SLC38A8 Pre-designed siRNA Set B
SI015098B 1 Each

Human SLC38A8 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Mouse Itgam/CD11b (Integrin alpha-M) ELISA Kit
RE2491M-01 48 Tests

Mouse Itgam/CD11b (Integrin alpha-M) ELISA Kit

Sign In for Pricing
View Details
Mouse Itgam/CD11b (Integrin alpha-M) ELISA Kit
RE2491M-02 96 Tests

Mouse Itgam/CD11b (Integrin alpha-M) ELISA Kit

Sign In for Pricing
View Details
Human HOXB9 Knockout A549 cell line
GTR15422805 1 Vial

Human HOXB9 Knockout A549 cell line

Sign In for Pricing
View Details
VAPA, CT (VAPA, VAP33, Vesicle-associated membrane protein-associated protein A, 33kD VAMP-associated protein) (MaxLight 750)
MBS6362244-01 0.1 mL

VAPA, CT (VAPA, VAP33, Vesicle-associated membrane protein-associated protein A, 33kD VAMP-associated protein) (MaxLight 750)

Sign In for Pricing
View Details