Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Kit ligand (KITLG), partial , Active Protein

Recombinant Human Kit ligand (KITLG), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Kit ligand (KITLG) . Accession Number: P21583; KITLG. Expression Region: 26-189aa. Tag Info: C-terminal 10xHis-tagged. Theoretical MW: 19.8kda. Target Synonyms: Kit ligand; Mast cell growth factor; Stem cell factor; c-Kit ligand; Soluble KIT ligand Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Kit ligand (KITLG), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P21583; KITLG

Expression Region

26-189aa

Host

Mammalian Cells

Target

Kit ligand (KITLG)

Conjugation

Unconjugated

Tag

C-Terminal 10xHis-Tagged

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

19.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Kit ligand; Mast cell growth factor; Stem cell factor; c-Kit ligand; Soluble KIT ligand

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thiomalic acid
TRC-T140510-1G 1 g

Thiomalic acid

Sign In for Pricing
View Details
Mini Sample Mouse PDGF-BB (Platelet Derived Growth Factor BB) ELISA Kit
E-MSEL-M0090-01 24 Tests

Mini Sample Mouse PDGF-BB (Platelet Derived Growth Factor BB) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse PDGF-BB (Platelet Derived Growth Factor BB) ELISA Kit
E-MSEL-M0090-02 48 Tests

Mini Sample Mouse PDGF-BB (Platelet Derived Growth Factor BB) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse PDGF-BB (Platelet Derived Growth Factor BB) ELISA Kit
E-MSEL-M0090-03 96 Tests

Mini Sample Mouse PDGF-BB (Platelet Derived Growth Factor BB) ELISA Kit

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS802934 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
Fmoc-Trp (Boc) TentaGel® S TRT Resin
SA1228.1G 1 g

Fmoc-Trp (Boc) TentaGel® S TRT Resin

Sign In for Pricing
View Details