Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Activin receptor type-2B (ACVR2B), partial , Active Protein

Recombinant Human Activin receptor type-2B (ACVR2B), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Activin receptor type-2B (ACVR2B) . Accession Number: Q13705; ACVR2B. Expression Region: 19-137aa. Tag Info: C-terminal 10xHis-tagged. Theoretical MW: 15.0kda. Target Synonyms: Activin receptor type-2B; EC:2.7.11.30; Activin receptor type IIB (ACTR-IIB) ; ACVR2B Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Activin receptor type-2B (ACVR2B), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

Q13705; ACVR2B

Expression Region

19-137aa

Host

Mammalian Cells

Target

Activin receptor type-2B (ACVR2B)

Conjugation

Unconjugated

Tag

C-Terminal 10xHis-Tagged

Field of Research

Signal Transduction

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

15.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Activin receptor type-2B; EC:2.7.11.30; Activin receptor type IIB (ACTR-IIB) ; ACVR2B

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTLLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(7-Bromo-1,3-dioxaindan-5-yl) methanamine
UTB22567-01 1000 mg

(7-Bromo-1,3-dioxaindan-5-yl) methanamine

Sign In for Pricing
View Details
(7-Bromo-1,3-dioxaindan-5-yl) methanamine
UTB22567-02 5000 mg

(7-Bromo-1,3-dioxaindan-5-yl) methanamine

Sign In for Pricing
View Details
(7-Bromo-1,3-dioxaindan-5-yl) methanamine
UTB22567-03 10000 mg

(7-Bromo-1,3-dioxaindan-5-yl) methanamine

Sign In for Pricing
View Details
Recombinant Mouse LIM domain-containing protein 2 (Limd2)
MBS1356750-01 0.02 mg (E-Coli)

Recombinant Mouse LIM domain-containing protein 2 (Limd2)

Sign In for Pricing
View Details
Recombinant Mouse LIM domain-containing protein 2 (Limd2)
MBS1356750-02 0.1 mg (E-Coli)

Recombinant Mouse LIM domain-containing protein 2 (Limd2)

Sign In for Pricing
View Details
Recombinant Mouse LIM domain-containing protein 2 (Limd2)
MBS1356750-03 0.02 mg (Yeast)

Recombinant Mouse LIM domain-containing protein 2 (Limd2)

Sign In for Pricing
View Details