Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Activin receptor type-2B (ACVR2B), partial , Active Protein

Recombinant Human Activin receptor type-2B (ACVR2B), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Activin receptor type-2B (ACVR2B) . Accession Number: Q13705; ACVR2B. Expression Region: 19-137aa. Tag Info: C-terminal 10xHis-tagged. Theoretical MW: 15.0kda. Target Synonyms: Activin receptor type-2B; EC:2.7.11.30; Activin receptor type IIB (ACTR-IIB) ; ACVR2B Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Activin receptor type-2B (ACVR2B), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

Q13705; ACVR2B

Expression Region

19-137aa

Host

Mammalian Cells

Target

Activin receptor type-2B (ACVR2B)

Conjugation

Unconjugated

Tag

C-Terminal 10xHis-Tagged

Field of Research

Signal Transduction

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

15.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Activin receptor type-2B; EC:2.7.11.30; Activin receptor type IIB (ACTR-IIB) ; ACVR2B

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTLLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ceacam1 (BC016891) Mouse Tagged Lenti ORF Clone
MR207256L4 10 µg

Ceacam1 (BC016891) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
B3GNT6, ID (B3GNT6, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 6, Core 3 synthase) (MaxLight 405)
MBS6277167-01 0.1 mL

B3GNT6, ID (B3GNT6, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 6, Core 3 synthase) (MaxLight 405)

Sign In for Pricing
View Details
B3GNT6, ID (B3GNT6, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 6, Core 3 synthase) (MaxLight 405)
MBS6277167-02 5x 0.1 mL

B3GNT6, ID (B3GNT6, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 6, Core 3 synthase) (MaxLight 405)

Sign In for Pricing
View Details
Human Interleukin 1beta (IL-1beta) ELISA Kit
MBS281439-01 48 Tests

Human Interleukin 1beta (IL-1beta) ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 1beta (IL-1beta) ELISA Kit
MBS281439-02 96 Tests

Human Interleukin 1beta (IL-1beta) ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 1beta (IL-1beta) ELISA Kit
MBS281439-03 5x 96 Tests

Human Interleukin 1beta (IL-1beta) ELISA Kit

Sign In for Pricing
View Details