Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Activin receptor type-2A (ACVR2A), partial , Active Protein

Recombinant Human Activin receptor type-2A (ACVR2A), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Activin receptor type-2A (ACVR2A) . Accession Number: P27037; ACVR2A. Expression Region: 20-135aa. Tag Info: C-terminal 10xHis-tagged. Theoretical MW: 14.8kDa. Target Synonyms: Activin receptor type-2A; EC:2.7.11.30; Activin receptor type IIA (ACTR-IIA; ACTRIIA) ; ACVR2A; ACVR2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Activin receptor type-2A (ACVR2A), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P27037; ACVR2A

Expression Region

20-135aa

Host

Mammalian Cells

Target

Activin receptor type-2A (ACVR2A)

Conjugation

Unconjugated

Tag

C-Terminal 10xHis-Tagged

Field of Research

Signal Transduction

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

14.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Activin receptor type-2A; EC:2.7.11.30; Activin receptor type IIA (ACTR-IIA; ACTRIIA) ; ACVR2A; ACVR2

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal MITF Antibody (MITF/2987R) [mFluor Violet 450 SE]
NBP3-08590MFV450 0.1 mL

Rabbit Monoclonal MITF Antibody (MITF/2987R) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
PSMD5 siRNA (h)
sc-92791 10 µM

PSMD5 siRNA (h)

Sign In for Pricing
View Details
Epigen, Recombinant, Human
MBS650398-01 0.005 mg

Epigen, Recombinant, Human

Sign In for Pricing
View Details
Epigen, Recombinant, Human
MBS650398-02 0.025 mg

Epigen, Recombinant, Human

Sign In for Pricing
View Details
Epigen, Recombinant, Human
MBS650398-03 5x 0.025 mg

Epigen, Recombinant, Human

Sign In for Pricing
View Details
Mouse Monoclonal GAPDH Antibody (1A10) [Alexa Fluor 532]
NBP1-47339AF532 0.1 mL

Mouse Monoclonal GAPDH Antibody (1A10) [Alexa Fluor 532]

Sign In for Pricing
View Details