Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Activin receptor type-2A (ACVR2A), partial , Active Protein

Recombinant Human Activin receptor type-2A (ACVR2A), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Activin receptor type-2A (ACVR2A) . Accession Number: P27037; ACVR2A. Expression Region: 20-135aa. Tag Info: C-terminal 10xHis-tagged. Theoretical MW: 14.8kDa. Target Synonyms: Activin receptor type-2A; EC:2.7.11.30; Activin receptor type IIA (ACTR-IIA; ACTRIIA) ; ACVR2A; ACVR2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Activin receptor type-2A (ACVR2A), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P27037; ACVR2A

Expression Region

20-135aa

Host

Mammalian Cells

Target

Activin receptor type-2A (ACVR2A)

Conjugation

Unconjugated

Tag

C-Terminal 10xHis-Tagged

Field of Research

Signal Transduction

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

14.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Activin receptor type-2A; EC:2.7.11.30; Activin receptor type IIA (ACTR-IIA; ACTRIIA) ; ACVR2A; ACVR2

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

COX18 Rabbit pAb, Pacific Blue conjugated
orb2820793 100 µL

COX18 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Lentiviral mouse Plin4 shRNA (UAS) - Lentiviral mouse Plin4 shRNA (UAS, GFP) plasmid
GTR15165394 1 Vial

Lentiviral mouse Plin4 shRNA (UAS) - Lentiviral mouse Plin4 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
KRT222P (KRT222) (NM_152349) Human Over-expression Lysate
LS125113-100ug 100 µg

KRT222P (KRT222) (NM_152349) Human Over-expression Lysate

Sign In for Pricing
View Details
Lentiviral human CHRNE shRNA (UAS) - Lentiviral human CHRNE shRNA (UAS, iRFP) (25)
GTR15339557 1 Vial

Lentiviral human CHRNE shRNA (UAS) - Lentiviral human CHRNE shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
BRAP Mouse Monoclonal Antibody [Clone ID: 1E7-C9-D10-B10]
TA346897 100 µL

BRAP Mouse Monoclonal Antibody [Clone ID: 1E7-C9-D10-B10]

Sign In for Pricing
View Details
Natriuretic Peptide Receptor B Rabbit Polyclonal Antibody (APC)
orb1007032 100 µL

Natriuretic Peptide Receptor B Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details