Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Finegoldia magna ATCC 53516 LPXTG-motif cell wall anchor domain protein, partial , Active Protein

Recombinant Finegoldia magna ATCC 53516 LPXTG-motif cell wall anchor domain protein, partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Finegoldia magna ATCC 53516. Target Name: LPXTG-motif cell wall anchor domain protein. Accession Number: D6S9W1; Protein L. Expression Region: 106-470aa. Tag Info: N-terminal 10xHis-tagged. Theoretical MW: 43.3kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Finegoldia magna ATCC 53516 LPXTG-motif cell wall anchor domain protein, partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

D6S9W1; Protein L

Expression Region

106-470aa

Host

Mammalian Cells

Target

LPXTG-motif cell wall anchor domain protein

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged

Field of Research

Others

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

43.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Finegoldia magna ATCC 53516

Protein Name

Active Recombinant Protein

AA Sequence

KEETPETPETDSEEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFEEATAEAYRYADALKKDNGEYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFEEATAEAYRYADLLAKENGKYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFAEATAEAYRYADLLAKENGKYTADLEDGGYTINIRFAGKKVDEKPEEKEQVTIKENIYFEDGTVQTATFKGTFAEATAEAYRYADLLSKEHGKYTADLEDGGYTINIRFAG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMOD3 Protein Vector (Mouse) (pPM-C-His)
PV240021 500 ng

TMOD3 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
TTPA Protein Vector (Rat) (pPM-C-HA)
PV313648 500 ng

TTPA Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Monkey NADH-ubiquinone oxidoreductase chain 1 (MT-ND1) ELISA Kit
MBS7226987-01 48 Well

Monkey NADH-ubiquinone oxidoreductase chain 1 (MT-ND1) ELISA Kit

Sign In for Pricing
View Details
Monkey NADH-ubiquinone oxidoreductase chain 1 (MT-ND1) ELISA Kit
MBS7226987-02 96 Well

Monkey NADH-ubiquinone oxidoreductase chain 1 (MT-ND1) ELISA Kit

Sign In for Pricing
View Details
Monkey NADH-ubiquinone oxidoreductase chain 1 (MT-ND1) ELISA Kit
MBS7226987-03 5x 96 Well

Monkey NADH-ubiquinone oxidoreductase chain 1 (MT-ND1) ELISA Kit

Sign In for Pricing
View Details
Monkey NADH-ubiquinone oxidoreductase chain 1 (MT-ND1) ELISA Kit
MBS7226987-04 10x 96 Well

Monkey NADH-ubiquinone oxidoreductase chain 1 (MT-ND1) ELISA Kit

Sign In for Pricing
View Details