Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD276 antigen (CD276), partial , Active Protein

Recombinant Human CD276 antigen (CD276), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: CD276 antigen (CD276) . Accession Number: Q5ZPR3-2; CD276. Expression Region: 29-245aa. Tag Info: C-terminal 10xHis-tagged. Theoretical MW: 24.7kda. Target Synonyms: 4Ig-B7-H3; B7 homolog 3 (B7-H3) ; Costimulatory molecule; CD276 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human CD276 antigen (CD276), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

Q5ZPR3-2; CD276

Expression Region

29-245aa

Host

Mammalian Cells

Target

CD276 antigen (CD276)

Conjugation

Unconjugated

Tag

C-Terminal 10xHis-Tagged

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial of Isoform 2

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

24.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

4Ig-B7-H3; B7 homolog 3 (B7-H3) ; Costimulatory molecule; CD276

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (MaxLight 650)
214642-ML650 100 µL

CD28 (MaxLight 650)

Sign In for Pricing
View Details
Anti-CD19 Antibody-APC/Cy5.5 labled
MBS8321335-01 25 Assays

Anti-CD19 Antibody-APC/Cy5.5 labled

Sign In for Pricing
View Details
Anti-CD19 Antibody-APC/Cy5.5 labled
MBS8321335-02 100 Assays

Anti-CD19 Antibody-APC/Cy5.5 labled

Sign In for Pricing
View Details
Anti-CD19 Antibody-APC/Cy5.5 labled
MBS8321335-03 5x 100 Assays

Anti-CD19 Antibody-APC/Cy5.5 labled

Sign In for Pricing
View Details
Human FAM113B (PCED1B) (NM_001281429) AAV Particle
RC238195A1V 250 µL

Human FAM113B (PCED1B) (NM_001281429) AAV Particle

Sign In for Pricing
View Details
T4 Polynucleotide Kinase
K013-B 500 U

T4 Polynucleotide Kinase

Sign In for Pricing
View Details