Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD276 antigen (CD276), partial , Active Protein

Recombinant Human CD276 antigen (CD276), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: CD276 antigen (CD276) . Accession Number: Q5ZPR3-2; CD276. Expression Region: 29-245aa. Tag Info: C-terminal 10xHis-tagged. Theoretical MW: 24.7kda. Target Synonyms: 4Ig-B7-H3; B7 homolog 3 (B7-H3) ; Costimulatory molecule; CD276 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human CD276 antigen (CD276), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

Q5ZPR3-2; CD276

Expression Region

29-245aa

Host

Mammalian Cells

Target

CD276 antigen (CD276)

Conjugation

Unconjugated

Tag

C-Terminal 10xHis-Tagged

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial of Isoform 2

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

24.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

4Ig-B7-H3; B7 homolog 3 (B7-H3) ; Costimulatory molecule; CD276

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P,P'-[1-Hydroxy-2-(4-pyridinyl)ethylidene]bis-phosphonic Acid
TRC-H952815-25MG 25 mg

P,P'-[1-Hydroxy-2-(4-pyridinyl)ethylidene]bis-phosphonic Acid

Sign In for Pricing
View Details
Cyclin B1 (phospho Ser147) Polyclonal Antibody
E44H01175 100 µL

Cyclin B1 (phospho Ser147) Polyclonal Antibody

Sign In for Pricing
View Details
LDH-A (E-9) : m-IgGκ BP-HRP Bundle
sc-521470 1 Kit

LDH-A (E-9) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
PKCδ Antibody [G9A5]
C15580-20uL 20 µL

PKCδ Antibody [G9A5]

Sign In for Pricing
View Details
Recombinant Rat EGF/ Epidermal Growth Factor Protein, Untagged, E.coli-1mg
QP1535-1mg 1mg

Recombinant Rat EGF/ Epidermal Growth Factor Protein, Untagged, E.coli-1mg

Sign In for Pricing
View Details
Zc4h2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4305405 3x 1.0 µg

Zc4h2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details