Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis G protein-coupled receptor 20 (GPR20) -VLPs , Active Protein

Recombinant Macaca fascicularis G protein-coupled receptor 20 (GPR20) -VLPs , Active Protein is a purified MP-VLP Transmembrane Protein; Active Protein. Purity: The purity information is not available for VLPs proteins. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) . Target Name: G protein-coupled receptor 20 (GPR20) -VLPs. Accession Number: XP_015310747.1; GPR20 Cynomolgus-VLPs. Expression Region: 1-359aa. Tag Info: C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions) . Theoretical MW: 40.2kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Macaca fascicularis G protein-coupled receptor 20 (GPR20) -VLPs , Active Protein is a purified MP-VLP Transmembrane Protein; Active Protein.

Accession Number

XP_015310747.1; GPR20 Cynomolgus-VLPs

Expression Region

1-359aa

Host

Mammalian Cells

Target

G protein-coupled receptor 20 (GPR20) -VLPs

Conjugation

Unconjugated

Tag

C-Terminal 10xHis-Tagged (This tag can be tested only under denaturing conditions)

Field of Research

Signal Transduction

Endotoxin

<1.0 EU/ug, by LAL method

Purity

The purity information is not available for VLPs proteins

Activity

Biologically Active

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

40.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Protein Name

MP-VLP Transmembrane Protein; Active Protein

AA Sequence

MPSVSPVGPSAGAVPNATAVTTVWTNASGLEVPLFHLFARLDEELHGTFPGLWLALMAVHGAIFLVGLVLNGLALYVFCCRTQAKTPSVIYTINLVVTDLLVGLSLPTRFAVYYGARGCLHCAFPHVLGYFLNMHCSILFLTCICVDRYLAIVRPEGSRRCRQPACARAVCAFVWLAAGAVTLSVLGMTGGRPCCRVFALTVLEFLLPLLVISVFTGRIMCALSRPGLLRQGRQRRVRAMQLLLTVLIIFLVCFTPFHARQVAVALWPDMPHHASLVVYHVAVTLSSLNSCMDPIVYCFVTSGFQATVRGLFGQHRGEREPSSGDVVSMHRSSKGSGRHHILSAGPHALTQALANGPEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (1.4C3), CF594 conjugate, 0.1mg/mL
BNC940149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF568 conjugate, 0.1mg/mL
BNC680861-100 1x 100 µL

HSP27 (G3.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL
BNC941429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL
BNC880525-500 1x 500 µL

CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL
BNC400276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF740 conjugate, 0.1mg/mL
BNC740017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details