Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human G-protein coupled receptor 20 (GPR20) -VLPs , Active Protein

Recombinant Human G-protein coupled receptor 20 (GPR20) -VLPs , Active Protein is a purified MP-VLP Transmembrane Protein; Active Protein. Purity: The purity information is not available for VLPs proteins. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: G-protein coupled receptor 20 (GPR20) -VLPs. Accession Number: Q99678; GPR20 Human-VLPs. Expression Region: 1-358aa. Tag Info: C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions) . Theoretical MW: 40.0kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human G-protein coupled receptor 20 (GPR20) -VLPs , Active Protein is a purified MP-VLP Transmembrane Protein; Active Protein.

Accession Number

Q99678; GPR20 Human-VLPs

Expression Region

1-358aa

Host

Mammalian Cells

Target

G-protein coupled receptor 20 (GPR20) -VLPs

Conjugation

Unconjugated

Tag

C-Terminal 10xHis-Tagged (This tag can be tested only under denaturing conditions)

Field of Research

Signal Transduction

Endotoxin

<1.0 EU/ug, by LAL method

Purity

The purity information is not available for VLPs proteins

Activity

Biologically Active

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

40.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Human (Homo sapiens)

Protein Name

MP-VLP Transmembrane Protein; Active Protein

AA Sequence

MPSVSPAGPSAGAVPNATAVTTVRTNASGLEVPLFHLFARLDEELHGTFPGLWLALMAVHGAIFLAGLVLNGLALYVFCCRTRAKTPSVIYTINLVVTDLLVGLSLPTRFAVYYGARGCLRCAFPHVLGYFLNMHCSILFLTCICVDRYLAIVRPEGSRRCRQPACARAVCAFVWLAAGAVTLSVLGVTGSRPCCRVFALTVLEFLLPLLVISVFTGRIMCALSRPGLLHQGRQRRVRAMQLLLTVLIIFLVCFTPFHARQVAVALWPDMPHHTSLVVYHVAVTLSSLNSCMDPIVYCFVTSGFQATVRGLFGQHGEREPSSGDVVSMHRSSKGSGRHHILSAGPHALTQALANGPEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CEACAM1/CD66a Protein (His Tag)
PKSH033739-01 10 µg

Recombinant Human CEACAM1/CD66a Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CEACAM1/CD66a Protein (His Tag)
PKSH033739-02 50 µg

Recombinant Human CEACAM1/CD66a Protein (His Tag)

Sign In for Pricing
View Details
2-Chloropropanoic acid
TRC-C381040-5G 5 g

2-Chloropropanoic acid

Sign In for Pricing
View Details
MRC1L1 Human Gene Knockout Kit (CRISPR)
KN423814 1 Kit

MRC1L1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZNF625 (N-term) Rabbit Polyclonal Antibody
AP54703PU-N 400 µL

ZNF625 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MOX1 (MEOX1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4D3]
TA804820BM 100 µL

MOX1 (MEOX1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4D3]

Sign In for Pricing
View Details