Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Urokinase-type plasminogen activator (PLAU), Active Protein

Recombinant Human Urokinase-type plasminogen activator (PLAU), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Urokinase-type plasminogen activator (PLAU) . Accession Number: P00749; PLAU. Expression Region: 21-431aa. Tag Info: C-terminal 10xHis-tagged. Theoretical MW: 47.9kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Urokinase-type plasminogen activator (PLAU), Active Protein is a purified Active Recombinant Protein.

Accession Number

P00749; PLAU

Expression Region

21-431aa

Host

Mammalian Cells

Target

Urokinase-type plasminogen activator (PLAU)

Conjugation

Unconjugated

Tag

C-Terminal 10xHis-Tagged

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

47.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SRGAP2 sgRNA gene knockout kit - Lentiviral human SRGAP2 sgRNA gene knockout kit (100)
GTR15375151 1 Vial

Lentiviral human SRGAP2 sgRNA gene knockout kit - Lentiviral human SRGAP2 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
MST1R Rabbit Polyclonal Antibody (RBITC)
orb1044570 100 µL

MST1R Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
GalNAc-T11 CRISPR Activation Plasmid (h)
sc-409314-ACT 20 µg

GalNAc-T11 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Mouse C57 Diaphragm cDNA
MD-605-C57 30 Reactions

Mouse C57 Diaphragm cDNA

Sign In for Pricing
View Details
Rabbit Monoclonal Annexin A1 Antibody (ANXA1/3869R) [DyLight 350]
NBP3-08709UV 100 µL

Rabbit Monoclonal Annexin A1 Antibody (ANXA1/3869R) [DyLight 350]

Sign In for Pricing
View Details
RNF113B Peptide
orb2017868 100 µg

RNF113B Peptide

Sign In for Pricing
View Details