Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Zinc transporter ZIP6 isoform X1 (SLC39A6), partial , Active Protein

Recombinant Macaca fascicularis Zinc transporter ZIP6 isoform X1 (SLC39A6), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) . Target Name: Zinc transporter ZIP6 isoform X1 (SLC39A6) . Accession Number: XP_005586923.1; SLC39A6. Expression Region: 21-309aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 33.6kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Macaca fascicularis Zinc transporter ZIP6 isoform X1 (SLC39A6), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

XP_005586923.1; SLC39A6

Expression Region

21-309aa

Host

Baculovirus

Target

Zinc transporter ZIP6 isoform X1 (SLC39A6)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Protein Name

Active Recombinant Protein

AA Sequence

LHELKSAAAFPQTTEKISPNWESGINVDLAITTRQYHLQQLFYRYGENNSLSVEGFRKLLQNIGIDKIKRIHIHHDHDHHSDHEHHSDHEHHSDHEHHSHRNHAASGKNKRKALCPEHDSDSSGKDPRNSQGKGAHRPEHANGRRNVKDSVSTSEVTSTVYNTVSEGTHFLETIETPKLFPKDVSSSTPPSVTEKSLVSRLAGRKTNESMSEPRKGFMYSRNTNENPQECFNASKLLTSHGMGIQVPLNATEFNYLCPAIINQIDARSCLIHTSEKKAEIPPKTYSLQI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUMO2 (Small Ubiquitin-related Modifier 2, HSMT3, MGC117191, SMT3B, SMT3H2, SUMO3, Smt3A,HSMT3,SMT3 homolog 2, SUMO-3, Sentrin-2, Ubiquitin-like Protein SMT3A) (MaxLight 405)
MBS6439580-01 0.1 mL

SUMO2 (Small Ubiquitin-related Modifier 2, HSMT3, MGC117191, SMT3B, SMT3H2, SUMO3, Smt3A,HSMT3,SMT3 homolog 2, SUMO-3, Sentrin-2, Ubiquitin-like Protein SMT3A) (MaxLight 405)

Sign In for Pricing
View Details
SUMO2 (Small Ubiquitin-related Modifier 2, HSMT3, MGC117191, SMT3B, SMT3H2, SUMO3, Smt3A,HSMT3,SMT3 homolog 2, SUMO-3, Sentrin-2, Ubiquitin-like Protein SMT3A) (MaxLight 405)
MBS6439580-02 5x 0.1 mL

SUMO2 (Small Ubiquitin-related Modifier 2, HSMT3, MGC117191, SMT3B, SMT3H2, SUMO3, Smt3A,HSMT3,SMT3 homolog 2, SUMO-3, Sentrin-2, Ubiquitin-like Protein SMT3A) (MaxLight 405)

Sign In for Pricing
View Details
Gm4312 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4327008 1.0 µg DNA

Gm4312 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Rat SLC28A2 shRNA Plasmid
abx986046-01 150 µg

Rat SLC28A2 shRNA Plasmid

Sign In for Pricing
View Details
Rat SLC28A2 shRNA Plasmid
abx986046-02 300 µg

Rat SLC28A2 shRNA Plasmid

Sign In for Pricing
View Details
Lentiviral mouse Cbwd1 shRNA (UAS) - Lentiviral mouse Cbwd1 shRNA (UAS, GFP) plasmid
GTR15181054 1 Vial

Lentiviral mouse Cbwd1 shRNA (UAS) - Lentiviral mouse Cbwd1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details