Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Zinc transporter ZIP6 isoform X1 (SLC39A6), partial , Active Protein

Recombinant Macaca fascicularis Zinc transporter ZIP6 isoform X1 (SLC39A6), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) . Target Name: Zinc transporter ZIP6 isoform X1 (SLC39A6) . Accession Number: XP_005586923.1; SLC39A6. Expression Region: 21-309aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 33.6kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Macaca fascicularis Zinc transporter ZIP6 isoform X1 (SLC39A6), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

XP_005586923.1; SLC39A6

Expression Region

21-309aa

Host

Baculovirus

Target

Zinc transporter ZIP6 isoform X1 (SLC39A6)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Protein Name

Active Recombinant Protein

AA Sequence

LHELKSAAAFPQTTEKISPNWESGINVDLAITTRQYHLQQLFYRYGENNSLSVEGFRKLLQNIGIDKIKRIHIHHDHDHHSDHEHHSDHEHHSDHEHHSHRNHAASGKNKRKALCPEHDSDSSGKDPRNSQGKGAHRPEHANGRRNVKDSVSTSEVTSTVYNTVSEGTHFLETIETPKLFPKDVSSSTPPSVTEKSLVSRLAGRKTNESMSEPRKGFMYSRNTNENPQECFNASKLLTSHGMGIQVPLNATEFNYLCPAIINQIDARSCLIHTSEKKAEIPPKTYSLQI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPA9 (GRP75, HSPA9B, Stress-70 Protein, Mitochondrial, 75kD Glucose-regulated Protein, Heat Shock 70kD Protein 9, Mortalin, Peptide-binding Protein 74, MGC4500)
128134 100 µg

HSPA9 (GRP75, HSPA9B, Stress-70 Protein, Mitochondrial, 75kD Glucose-regulated Protein, Heat Shock 70kD Protein 9, Mortalin, Peptide-binding Protein 74, MGC4500)

Sign In for Pricing
View Details
Human Scaffold attachment factor B2, SAFB2 ELISA KIT
ELI-18884h 96 Tests

Human Scaffold attachment factor B2, SAFB2 ELISA KIT

Sign In for Pricing
View Details
SLC36A3 Protein Vector (Mouse) (pPB-N-His)
PV230695 500 ng

SLC36A3 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
GENLISA™ Rat Replication Protein A1 (RPA1) ELISA
KLR2236 1x 96 Well

GENLISA™ Rat Replication Protein A1 (RPA1) ELISA

Sign In for Pricing
View Details
LRAT Polyclonal Antibody
UB-GEN-1807 100 µL

LRAT Polyclonal Antibody

Sign In for Pricing
View Details
ZIK1, ID (ZIK1, ZNF762, Zinc finger protein interacting with ribonucleoprotein K, Zinc finger protein 762) (FITC)
MBS6365373-01 0.2 mL

ZIK1, ID (ZIK1, ZNF762, Zinc finger protein interacting with ribonucleoprotein K, Zinc finger protein 762) (FITC)

Sign In for Pricing
View Details