Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Zinc transporter ZIP6 isoform X1 (SLC39A6), partial , Active Protein

Recombinant Macaca fascicularis Zinc transporter ZIP6 isoform X1 (SLC39A6), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) . Target Name: Zinc transporter ZIP6 isoform X1 (SLC39A6) . Accession Number: XP_005586923.1; SLC39A6. Expression Region: 21-309aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 33.6kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Macaca fascicularis Zinc transporter ZIP6 isoform X1 (SLC39A6), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

XP_005586923.1; SLC39A6

Expression Region

21-309aa

Host

Baculovirus

Target

Zinc transporter ZIP6 isoform X1 (SLC39A6)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Protein Name

Active Recombinant Protein

AA Sequence

LHELKSAAAFPQTTEKISPNWESGINVDLAITTRQYHLQQLFYRYGENNSLSVEGFRKLLQNIGIDKIKRIHIHHDHDHHSDHEHHSDHEHHSDHEHHSHRNHAASGKNKRKALCPEHDSDSSGKDPRNSQGKGAHRPEHANGRRNVKDSVSTSEVTSTVYNTVSEGTHFLETIETPKLFPKDVSSSTPPSVTEKSLVSRLAGRKTNESMSEPRKGFMYSRNTNENPQECFNASKLLTSHGMGIQVPLNATEFNYLCPAIINQIDARSCLIHTSEKKAEIPPKTYSLQI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

VWF ELISA Kit| Monkey Von Willebrand Factor ELISA Kit
EF012766 96 Tests

VWF ELISA Kit| Monkey Von Willebrand Factor ELISA Kit

Sign In for Pricing
View Details
THEM4P1 CRISPR Knock Out 293T Cell Line (Human)
46650141 1x 10^6 Cells / 1.0 mL

THEM4P1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Human TRPV4 knockdown cell line
ABC-KD16186 1 Vial

Human TRPV4 knockdown cell line

Sign In for Pricing
View Details
Lentiviral human CGAS shRNA (UAS) - Lentiviral human CGAS shRNA (UAS, GFP) plasmid
GTR15124786 1 Vial

Lentiviral human CGAS shRNA (UAS) - Lentiviral human CGAS shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Mouse Rgmb (NM_178615) AAV Particle
MR220527A1V 250 µL

Mouse Rgmb (NM_178615) AAV Particle

Sign In for Pricing
View Details
Rabbit Polyclonal XAB2 Antibody
NBP2-20916 0.1 mL

Rabbit Polyclonal XAB2 Antibody

Sign In for Pricing
View Details