Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Zinc transporter ZIP6 isoform X1 (SLC39A6), partial , Active Protein

Recombinant Macaca fascicularis Zinc transporter ZIP6 isoform X1 (SLC39A6), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) . Target Name: Zinc transporter ZIP6 isoform X1 (SLC39A6) . Accession Number: XP_005586923.1; SLC39A6. Expression Region: 21-309aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 33.6kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Macaca fascicularis Zinc transporter ZIP6 isoform X1 (SLC39A6), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

XP_005586923.1; SLC39A6

Expression Region

21-309aa

Host

Baculovirus

Target

Zinc transporter ZIP6 isoform X1 (SLC39A6)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Protein Name

Active Recombinant Protein

AA Sequence

LHELKSAAAFPQTTEKISPNWESGINVDLAITTRQYHLQQLFYRYGENNSLSVEGFRKLLQNIGIDKIKRIHIHHDHDHHSDHEHHSDHEHHSDHEHHSHRNHAASGKNKRKALCPEHDSDSSGKDPRNSQGKGAHRPEHANGRRNVKDSVSTSEVTSTVYNTVSEGTHFLETIETPKLFPKDVSSSTPPSVTEKSLVSRLAGRKTNESMSEPRKGFMYSRNTNENPQECFNASKLLTSHGMGIQVPLNATEFNYLCPAIINQIDARSCLIHTSEKKAEIPPKTYSLQI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human OPHN1 protein, His-tagged
OPHN1-3772H 25 µg

Recombinant Human OPHN1 protein, His-tagged

Sign In for Pricing
View Details
ITLN2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1106808 1.0 µg DNA

ITLN2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
COPS4 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-62563R-BF405 100 µL

COPS4 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal B9D1 Antibody [mFluor Violet 500 SE]
NBP2-81899MFV500 0.1 mL

Rabbit Polyclonal B9D1 Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details
HMGN3, NT (HMGN3, TRIP7, High mobility group nucleosome-binding domain-containing protein 3, Thyroid receptor-interacting protein 7) (FITC) discontinued
036646-FITC 200 µL

HMGN3, NT (HMGN3, TRIP7, High mobility group nucleosome-binding domain-containing protein 3, Thyroid receptor-interacting protein 7) (FITC) discontinued

Sign In for Pricing
View Details
PKC eta (PRKCH) (NM_006255) Human Tagged Lenti ORF Clone
RC205272L1 10 µg

PKC eta (PRKCH) (NM_006255) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details