Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Zinc transporter ZIP6 isoform X1 (SLC39A6), partial , Active Protein

Recombinant Macaca fascicularis Zinc transporter ZIP6 isoform X1 (SLC39A6), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) . Target Name: Zinc transporter ZIP6 isoform X1 (SLC39A6) . Accession Number: XP_005586923.1; SLC39A6. Expression Region: 21-309aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 33.6kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Macaca fascicularis Zinc transporter ZIP6 isoform X1 (SLC39A6), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

XP_005586923.1; SLC39A6

Expression Region

21-309aa

Host

Baculovirus

Target

Zinc transporter ZIP6 isoform X1 (SLC39A6)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Protein Name

Active Recombinant Protein

AA Sequence

LHELKSAAAFPQTTEKISPNWESGINVDLAITTRQYHLQQLFYRYGENNSLSVEGFRKLLQNIGIDKIKRIHIHHDHDHHSDHEHHSDHEHHSDHEHHSHRNHAASGKNKRKALCPEHDSDSSGKDPRNSQGKGAHRPEHANGRRNVKDSVSTSEVTSTVYNTVSEGTHFLETIETPKLFPKDVSSSTPPSVTEKSLVSRLAGRKTNESMSEPRKGFMYSRNTNENPQECFNASKLLTSHGMGIQVPLNATEFNYLCPAIINQIDARSCLIHTSEKKAEIPPKTYSLQI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Epcam (Epithelial Cell Adhesion Molecule, Ep-CAM, Epithelial GlycoProtein 314, EGP314, mEGP314, Protein 289A, Tumor-Associated Calcium signal Transducer 1, CD326, Epcam, Tacstd1) (HRP) discontinued
302416-HRP 200 µL

Epcam (Epithelial Cell Adhesion Molecule, Ep-CAM, Epithelial GlycoProtein 314, EGP314, mEGP314, Protein 289A, Tumor-Associated Calcium signal Transducer 1, CD326, Epcam, Tacstd1) (HRP) discontinued

Sign In for Pricing
View Details
UCHL1 Antibody
GWB-MV453C 50 µg

UCHL1 Antibody

Sign In for Pricing
View Details
Rabbit anti-Surfactant Protein C Antibody
MBS4511374-01 0.05 mL

Rabbit anti-Surfactant Protein C Antibody

Sign In for Pricing
View Details
Rabbit anti-Surfactant Protein C Antibody
MBS4511374-02 0.1 mL

Rabbit anti-Surfactant Protein C Antibody

Sign In for Pricing
View Details
Rabbit anti-Surfactant Protein C Antibody
MBS4511374-03 5x 0.1 mL

Rabbit anti-Surfactant Protein C Antibody

Sign In for Pricing
View Details
Recombinant Human CD227/MUC1 Protein, C-Fc
HB102011-01 50 µg

Recombinant Human CD227/MUC1 Protein, C-Fc

Sign In for Pricing
View Details