Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Finegoldia magna ATCC 53516 LPXTG-motif cell wall anchor domain protein, partial , Active Protein

Recombinant Finegoldia magna ATCC 53516 LPXTG-motif cell wall anchor domain protein, partial , Active Protein is a purified Active Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Finegoldia magna ATCC 53516. Target Name: LPXTG-motif cell wall anchor domain protein. Accession Number: D6S9W1; Protein L. Expression Region: 106-470aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 47.4kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Finegoldia magna ATCC 53516 LPXTG-motif cell wall anchor domain protein, partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

D6S9W1; Protein L

Expression Region

106-470aa

Host

E. coli

Target

LPXTG-motif cell wall anchor domain protein

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

47.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Finegoldia magna ATCC 53516

Protein Name

Active Recombinant Protein

AA Sequence

KEETPETPETDSEEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFEEATAEAYRYADALKKDNGEYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFEEATAEAYRYADLLAKENGKYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFAEATAEAYRYADLLAKENGKYTADLEDGGYTINIRFAGKKVDEKPEEKEQVTIKENIYFEDGTVQTATFKGTFAEATAEAYRYADLLSKEHGKYTADLEDGGYTINIRFAG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Matrix Metalloproteinase 10 (MMP-10, Stromilysin 2, Transin 2) discontinued
M2426-14 500 µL

Matrix Metalloproteinase 10 (MMP-10, Stromilysin 2, Transin 2) discontinued

Sign In for Pricing
View Details
Human TMEM128 shRNA Plasmid
abx963753-01 150 µg

Human TMEM128 shRNA Plasmid

Sign In for Pricing
View Details
Human TMEM128 shRNA Plasmid
abx963753-02 300 µg

Human TMEM128 shRNA Plasmid

Sign In for Pricing
View Details
Luciferase Expressing C57BL/6 Mouse Lymphatic Endothelial Cells
ABC-TC106D 1 Vial

Luciferase Expressing C57BL/6 Mouse Lymphatic Endothelial Cells

Sign In for Pricing
View Details
Bcl-2 Blocking Peptide
MBS9620324-01 1 mg

Bcl-2 Blocking Peptide

Sign In for Pricing
View Details
Bcl-2 Blocking Peptide
MBS9620324-02 5x 1 mg

Bcl-2 Blocking Peptide

Sign In for Pricing
View Details