Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Platelet-derived growth factor subunit B (Pdgfb)

Recombinant Mouse Platelet-derived growth factor subunit B (Pdgfb) is a purified Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Platelet-derived growth factor subunit B (Pdgfb) . Accession Number: P31240; Pdgfb. Expression Region: 82-190aa. Tag Info: C-terminal Avi-tagged. Theoretical MW: 20.9kda. Target Synonyms: PDGF subunit B; PDGF-2; Platelet-derived growth factor B chain; Platelet-derived growth factor beta polypeptide; Proto-oncogene c-Sis Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Platelet-derived growth factor subunit B (Pdgfb) is a purified Recombinant Protein.

Accession Number

P31240; Pdgfb

Expression Region

82-190aa

Host

E. coli

Target

Platelet-derived growth factor subunit B (Pdgfb)

Conjugation

Unconjugated

Tag

C-Terminal Avi-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>95% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

20.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

PDGF subunit B; PDGF-2; Platelet-derived growth factor B chain; Platelet-derived growth factor beta polypeptide; Proto-oncogene c-Sis

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human COQ8B shRNA (UAS) - Lentiviral human COQ8B shRNA (UAS, RFP) plasmid
GTR15078013 1 Vial

Lentiviral human COQ8B shRNA (UAS) - Lentiviral human COQ8B shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Recombinant Mycobacterium abscessus GTPase obg (obg)
MBS1233245-01 0.02 mg (E-Coli)

Recombinant Mycobacterium abscessus GTPase obg (obg)

Sign In for Pricing
View Details
Recombinant Mycobacterium abscessus GTPase obg (obg)
MBS1233245-02 0.02 mg (Yeast)

Recombinant Mycobacterium abscessus GTPase obg (obg)

Sign In for Pricing
View Details
Recombinant Mycobacterium abscessus GTPase obg (obg)
MBS1233245-03 0.1 mg (E-Coli)

Recombinant Mycobacterium abscessus GTPase obg (obg)

Sign In for Pricing
View Details
Recombinant Mycobacterium abscessus GTPase obg (obg)
MBS1233245-04 0.1 mg (Yeast)

Recombinant Mycobacterium abscessus GTPase obg (obg)

Sign In for Pricing
View Details
Recombinant Mycobacterium abscessus GTPase obg (obg)
MBS1233245-05 0.02 mg (Baculovirus)

Recombinant Mycobacterium abscessus GTPase obg (obg)

Sign In for Pricing
View Details