Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transient receptor potential cation channel subfamily V member 4 (Trpv4), partial

Recombinant Mouse Transient receptor potential cation channel subfamily V member 4 (Trpv4), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Transient receptor potential cation channel subfamily V member 4 (Trpv4) . Accession Number: Q9EPK8; Trpv4. Expression Region: 723-871aa. Tag Info: Tag-Free. Theoretical MW: 17.3kda. Target Synonyms: TrpV4; Osm-9-like TRP channel 4; OTRPC4; Transient receptor potential protein 12; TRP12; Vanilloid receptor-like channel 2; Vanilloid receptor-like protein 2; Vanilloid receptor-related osmotically-activated channel; VR-OAC Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Transient receptor potential cation channel subfamily V member 4 (Trpv4), partial is a purified Recombinant Protein.

Accession Number

Q9EPK8; Trpv4

Expression Region

723-871aa

Host

E. coli

Target

Transient receptor potential cation channel subfamily V member 4 (Trpv4)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Neuroscience

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

TrpV4; Osm-9-like TRP channel 4; OTRPC4; Transient receptor potential protein 12; TRP12; Vanilloid receptor-like channel 2; Vanilloid receptor-like protein 2; Vanilloid receptor-related osmotically-activated channel; VR-OAC

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

GQVSKESKHIWKLQWATTILDIERSFPVFLRKAFRSGEMVTVGKSSDGTPDRRWCFRVDEVNWSHWNQNLGIINEDPGKSEIYQYYGFSHTVGRLRRDRWSSVVPRVVELNKNSSADEVVVPLDNLGNPNCDGHQQGYAPKWRTDDAPL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFRC Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-41331R-PE-Cy5.5 100 µL

TFRC Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
Aquaporin 6 (AQP-6) Human ELISA Kit
B6476 96 Tests

Aquaporin 6 (AQP-6) Human ELISA Kit

Sign In for Pricing
View Details
RABL6 siRNA (Mouse)
CRN2596-01 15 nmol

RABL6 siRNA (Mouse)

Sign In for Pricing
View Details
RABL6 siRNA (Mouse)
CRN2596-02 30 nmol

RABL6 siRNA (Mouse)

Sign In for Pricing
View Details
Human Liver Fibroblast Cells
AFG-ELL-1897 > 5x 10^5 Cells / Vial

Human Liver Fibroblast Cells

Sign In for Pricing
View Details
Rabbit Platelet Factor 4 ELISA Kit (PF4)
RK03434 96 Tests

Rabbit Platelet Factor 4 ELISA Kit (PF4)

Sign In for Pricing
View Details