Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transient receptor potential cation channel subfamily V member 4 (Trpv4), partial

Recombinant Mouse Transient receptor potential cation channel subfamily V member 4 (Trpv4), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Transient receptor potential cation channel subfamily V member 4 (Trpv4) . Accession Number: Q9EPK8; Trpv4. Expression Region: 723-871aa. Tag Info: Tag-Free. Theoretical MW: 17.3kda. Target Synonyms: TrpV4; Osm-9-like TRP channel 4; OTRPC4; Transient receptor potential protein 12; TRP12; Vanilloid receptor-like channel 2; Vanilloid receptor-like protein 2; Vanilloid receptor-related osmotically-activated channel; VR-OAC Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Transient receptor potential cation channel subfamily V member 4 (Trpv4), partial is a purified Recombinant Protein.

Accession Number

Q9EPK8; Trpv4

Expression Region

723-871aa

Host

E. coli

Target

Transient receptor potential cation channel subfamily V member 4 (Trpv4)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Neuroscience

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

TrpV4; Osm-9-like TRP channel 4; OTRPC4; Transient receptor potential protein 12; TRP12; Vanilloid receptor-like channel 2; Vanilloid receptor-like protein 2; Vanilloid receptor-related osmotically-activated channel; VR-OAC

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

GQVSKESKHIWKLQWATTILDIERSFPVFLRKAFRSGEMVTVGKSSDGTPDRRWCFRVDEVNWSHWNQNLGIINEDPGKSEIYQYYGFSHTVGRLRRDRWSSVVPRVVELNKNSSADEVVVPLDNLGNPNCDGHQQGYAPKWRTDDAPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC2 (CCP58), CF647 conjugate, 0.1mg/mL
BNC470032-500 1x 500 µL

MUC2 (CCP58), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF740 conjugate, 0.1mg/mL
BNC740176-500 1x 500 µL

CD5 (Cris-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF740 conjugate, 0.1mg/mL
BNC740266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL
BNC940096-100 1x 100 µL

Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF405S conjugate, 0.1mg/mL
BNC040745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF488A conjugate, 0.1mg/mL
BNC880645-100 1x 100 µL

FOXP3 (3G3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details