Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transient receptor potential cation channel subfamily V member 4 (Trpv4), partial

Recombinant Mouse Transient receptor potential cation channel subfamily V member 4 (Trpv4), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Transient receptor potential cation channel subfamily V member 4 (Trpv4) . Accession Number: Q9EPK8; Trpv4. Expression Region: 723-871aa. Tag Info: Tag-Free. Theoretical MW: 17.3kda. Target Synonyms: TrpV4; Osm-9-like TRP channel 4; OTRPC4; Transient receptor potential protein 12; TRP12; Vanilloid receptor-like channel 2; Vanilloid receptor-like protein 2; Vanilloid receptor-related osmotically-activated channel; VR-OAC Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Transient receptor potential cation channel subfamily V member 4 (Trpv4), partial is a purified Recombinant Protein.

Accession Number

Q9EPK8; Trpv4

Expression Region

723-871aa

Host

E. coli

Target

Transient receptor potential cation channel subfamily V member 4 (Trpv4)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Neuroscience

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

TrpV4; Osm-9-like TRP channel 4; OTRPC4; Transient receptor potential protein 12; TRP12; Vanilloid receptor-like channel 2; Vanilloid receptor-like protein 2; Vanilloid receptor-related osmotically-activated channel; VR-OAC

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

GQVSKESKHIWKLQWATTILDIERSFPVFLRKAFRSGEMVTVGKSSDGTPDRRWCFRVDEVNWSHWNQNLGIINEDPGKSEIYQYYGFSHTVGRLRRDRWSSVVPRVVELNKNSSADEVVVPLDNLGNPNCDGHQQGYAPKWRTDDAPL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IKK gamma (IKK3, NEMO, FIP3, IKKAP1, IkappaB Kinase gamma, IKKg) (MaxLight 405) discontinued
I3000-36-ML405 100 µL

IKK gamma (IKK3, NEMO, FIP3, IKKAP1, IkappaB Kinase gamma, IKKg) (MaxLight 405) discontinued

Sign In for Pricing
View Details
MSH2 Mouse Monoclonal Antibody [Clone ID: UMLBI259]
AMM21993VCF 100 µg

MSH2 Mouse Monoclonal Antibody [Clone ID: UMLBI259]

Sign In for Pricing
View Details
Legionella pneumophila Serogroup 1 (L. pneumophila) (AP) discontinued
L1663-28D-AP 100 µL

Legionella pneumophila Serogroup 1 (L. pneumophila) (AP) discontinued

Sign In for Pricing
View Details
GJA9 sgRNA CRISPR Lentivector (Human) (Target 2)
K0860303 1.0 µg DNA

GJA9 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
ACAT1 (ACACA) (NM_198839) Human Tagged ORF Clone
RC223987 10 µg

ACAT1 (ACACA) (NM_198839) Human Tagged ORF Clone

Sign In for Pricing
View Details
Methyl 2-hydroxy-5- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) benzoate
JH912832 1 Each

Methyl 2-hydroxy-5- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) benzoate

Sign In for Pricing
View Details