Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cysteine protease ATG4B (Atg4b)

Recombinant Mouse Cysteine protease ATG4B (Atg4b) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Cysteine protease ATG4B (Atg4b) . Accession Number: Q8BGE6; Atg4b. Expression Region: 1-393aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 51.3kda. Target Synonyms: AUT-like 1 cysteine endopeptidase; Autophagy-related cysteine endopeptidase 1; Autophagin-1; Autophagy-related protein 4 homolog B; MmAPG4B Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Cysteine protease ATG4B (Atg4b) is a purified Recombinant Protein.

Accession Number

Q8BGE6; Atg4b

Expression Region

1-393aa

Host

E. coli

Target

Cysteine protease ATG4B (Atg4b)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

51.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

AUT-like 1 cysteine endopeptidase; Autophagy-related cysteine endopeptidase 1; Autophagin-1; Autophagy-related protein 4 homolog B; MmAPG4B

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

MDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRRNFPAIGGTGPTSDTGWGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFNVLNAFLDRKDSYYSIHQIAQMGVGEGKSIGQWYGPNTVAQVLKKLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRANLPCAGAAALPTDSERHCNGFPAGAEVTNRPSAWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVELTDSCFIPDESFHCQHPPSRMGIGELDPSIAVGFFCKTEEDFNDWCQQVKKLSQLGGALPMFELVEQQPSHLACQDVLNLSLDSSDVERLERFFDSEDEDFEILSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 / MS4A1 (B-Cell Marker) (IGEL/1497R), CF405S conjugate, 0.1mg/mL
BNC041497-100 1x 100 µL

CD20 / MS4A1 (B-Cell Marker) (IGEL/1497R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mitofusin 2 (MFN2) (NM_014874) Human Over-expression Lysate
LC402384 20 µg

Mitofusin 2 (MFN2) (NM_014874) Human Over-expression Lysate

Sign In for Pricing
View Details
HER3 Recombinant Rabbit Monoclonal Antibody [R4]
HA721135 100 µL

HER3 Recombinant Rabbit Monoclonal Antibody [R4]

Sign In for Pricing
View Details
GNAS Mouse Monoclonal Antibody [A8F12]
HA601074 100 µL

GNAS Mouse Monoclonal Antibody [A8F12]

Sign In for Pricing
View Details
Human Kappa Light Chain (KLC264), CF647 conjugate, 0.1mg/mL
BNC470264-500 1x 500 µL

Human Kappa Light Chain (KLC264), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OR1J1 Human Gene Knockout Kit (CRISPR)
KN418504 1 Kit

OR1J1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details