Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Serine protease inhibitor Kazal-type 4 (Spink4)

Recombinant Mouse Serine protease inhibitor Kazal-type 4 (Spink4) is a purified Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Serine protease inhibitor Kazal-type 4 (Spink4) . Accession Number: O35679; Spink4. Expression Region: 27-86aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 8.2kda. Target Synonyms: MPGC60 protein; Peptide PEC-60 homolog Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Serine protease inhibitor Kazal-type 4 (Spink4) is a purified Recombinant Protein.

Accession Number

O35679; Spink4

Expression Region

27-86aa

Host

Yeast

Target

Serine protease inhibitor Kazal-type 4 (Spink4)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>95% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

8.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

MPGC60 protein; Peptide PEC-60 homolog

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

GSLVFPRMPFCEHMAELPNCPQTPNLICGTDGLTYENECHLCLTRMKTMKDIQIMKDGQC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Campylobacter Curvus rpmB Protein (aa 1-63)
VAng-Lsx6029-50gEcoli 50 µg (E. coli)

Recombinant Campylobacter Curvus rpmB Protein (aa 1-63)

Sign In for Pricing
View Details
Human Lysyl Oxidase Like Protein 2 (LOXL2) ELISA Kit
RD-LOXL2-Hu-48Tests 48 Tests

Human Lysyl Oxidase Like Protein 2 (LOXL2) ELISA Kit

Sign In for Pricing
View Details
Synphilin-1, CT (Sph1, Alpha-synuclein-interacting Protein, SNCAIP) (APC) discontinued
S9116-01C-APC 200 µL

Synphilin-1, CT (Sph1, Alpha-synuclein-interacting Protein, SNCAIP) (APC) discontinued

Sign In for Pricing
View Details
SELRC1 (Sel1 Repeat-containing Protein 1, Beta-lactamase hcp-like Protein, C1orf163), FLJ12439) (FITC)
133092-FITC 100 µL

SELRC1 (Sel1 Repeat-containing Protein 1, Beta-lactamase hcp-like Protein, C1orf163), FLJ12439) (FITC)

Sign In for Pricing
View Details
Tectb ORF Vector (Rat) (pORF)
46476016 1.0 µg DNA

Tectb ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Tead1 3'UTR Luciferase Stable Cell Line
TU221743 1.0 mL

Tead1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details